KEGG   Ehrlichia chaffeensis Arkansas: ECH_0836Help
Entry
ECH_0836          CDS       T00328                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTA_TIM Phage-tail_3
Motif
Other DBs
NCBI-ProteinID: ABD44529
UniProt: Q2GG01
Position
850774..854379
Genome map
AA seq 1201 aa AA seqDB search
MSLIILSTIVNSVKESIEKFLLTEFSNIIHQDTQHNFSDSNIQTKHIPKINHLKIQTSSY
GKMIPILYGSMRIAGNIIWMDKITINTNKDITVINNPNKKSTSHSSIQYTYHTSLAIAIC
TGHVKKISKIWVNSQPLDLDTITYRFYQGTEDQEPDPLILKLMGDAPAYRGLSYIVIEDF
LLTDPKIPNFTFEVTAQSTNASYQEHITQKIKSIHIIPGSGEFAYDTKIQMKIFQQKIGK
QYIPYGKAQQINNHSRHQKADALISLDQLQESLPNVQWISVIVNWYTDSLNIKDCHIYPA
VEFKFDATTTPDNWHVAEINRETARQISQDNIIGGTINDKSLIRYIKELKTRGYKVLLYP
TIIADIQEDSWIGNLTGDAEYISTFFNEQYNPFIKHYCNLTKDIIDAIVIGSSFIGLTRI
KNHHNHYPAVDELIKLASYVKNQMGNNIIVTYAADWREYHSYNGYYNMDTLWSSKDIDVV
GINAYFPLTDIPQPIDGFSEQDIINGWCSGEGYDYFYTNPETKQGKIPYTENNHQYSWKN
IKKWWSQYHINPDNTITTWIPKLKKIWFTQYGFQSIDNCTSQPSVSIDYQYNKNPIFSKG
HVNFHAQKVAINGTIKTWDNSDIVEQMFLWGWDIRPYPHFPELKNTWKDAKNWQTGYWIQ
EKLSLLEISHIIYDLLKSTGLQNNQIKIQNLHNEIDGYIITERQSTKSILNVLKDLYNFE
IVEQDNTLAVIQENQLLLYNISSNDILSNDKNNSQKIIKTKASNLVHSINFMYINKNHEY
NVSSQRVRIPNFENSTIQDIQVPIVLSDNQAKTIAENILNKKSNNKYNFYLTLPIKYVWL
NTNDIIQVEYNHVLYKIKIINIYLENISISIEGVLYNSSLTTQHLIPDNDFNSYSDKYII
ENPIHIFDFPCIHNIDNILYFAITRIKSVWEGSILYSYEDQDEHYKNVLSIDTEATTGIT
ISNLGIGPIAIPDQTNKITIFLKTGQLHSIKSLFMDNSSNLALIGDEIIQFQNVKQIREN
IYQLSYMLRGRFGTERHIDQHHKKELFTLLDNLPYLKINQSLINKSLIYKVVLKKSTSYA
KQSTYTYYANNLKPLPVTHVKGNRDIYNNLTVNWVRRARINGEWNDNTDTPIDEKFESYD
IEISDNQNIVKRTITVKDSTTFVYSAQQQKIDFNSIQEKINVTIYQNSYIIGRGIAYKTT
L
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaattatactatcaaccattgtcaatagtgttaaagaatccatagaaaaattc
cttttaacagaattcagcaatattattcatcaagatacacaacataatttttcagattca
aacatccaaactaaacatataccaaaaatcaatcatttaaaaattcaaacatcctcatat
ggaaaaatgattcctatattatatggaagtatgcgtattgcaggtaacataatatggatg
gacaaaatcacaatcaatacaaacaaagatataactgttataaacaatccaaataaaaag
tctacaagccacagttctatacaatatacatatcatacaagtctagctatagcaatatgc
acaggacatgttaaaaaaatctcaaaaatatgggtcaattcacaaccattagatctagac
acaataacttatagattttaccaaggtacagaagaccaagaacctgatccactaatatta
aaattaatgggggatgcaccagcatatcgtggcttatcatatatagtaatagaagatttt
ttactaacagatccaaaaattcctaactttacattcgaagtaacagcacaatctactaat
gcctcttatcaagaacatataacacaaaaaatcaaaagtatacacattataccaggctct
ggagaatttgcatacgatacaaaaatacaaatgaaaatttttcaacaaaaaattggtaaa
cagtacattccttatggaaaagcacaacaaattaataaccacagtagacatcaaaaagca
gatgctttaatttccctagatcaattacaagaaagccttccaaatgtacagtggatatct
gttattgtaaattggtacacagatagtttaaatattaaagattgccatatttacccagcc
gttgagttcaaatttgatgctactacaacacctgacaactggcatgtagcagaaataaat
agagaaacagcaagacaaatttctcaggacaacattataggcggaactatcaatgataaa
tctttaattagatatattaaagaactcaaaacacgaggttacaaagtattactatatcct
acgatcatagcagatattcaagaagattcatggataggcaatcttactggagacgcagaa
tatataagcacattttttaatgagcaatataacccatttattaagcattattgcaattta
actaaagacataatagatgctattgtcattggttcaagttttatcggtttaactagaata
aaaaaccatcacaaccattatccagcagtagatgaattaataaagctagcaagttatgta
aaaaatcaaatgggtaacaacattattgtaacatatgcagcagactggagagaatatcac
tcttacaacggatattacaatatggacacactatggtcatcaaaagacattgatgtagta
ggtataaacgcatattttccattaacagatattcctcaacctatagatggattttcagaa
caagacataatcaatggatggtgttcaggagaaggatatgattacttctatactaatcca
gaaacaaaacaaggtaaaattccatatactgaaaataaccaccaatattcctggaaaaat
atcaagaaatggtggagtcaatatcacattaacccagacaataccatcaccacttggatt
ccaaaattaaaaaaaatatggtttactcaatatggatttcaaagtatagacaactgtaca
agtcaacctagcgtatccatagattatcaatacaataaaaacccaatcttttcaaaagga
catgtaaactttcatgcacaaaaagttgcaataaacggtaccatcaaaacatgggacaat
tctgatatagtagaacaaatgtttctttggggatgggatataaggccttatcctcacttc
ccagaactaaaaaatacctggaaagatgcaaaaaattggcaaaccggctattggatacaa
gaaaaattatccttgctcgaaatctctcacataatctacgatttactaaaaagcacaggg
ctacaaaataatcaaatcaaaatacaaaacctacacaatgaaatagatggatatataatt
actgaaagacaatctacaaaatccatattaaatgtactaaaagatttatataactttgaa
atagtcgagcaagataatacgttagctgttattcaagaaaatcaactgcttctatacaat
atttcatcaaatgatattctatccaacgataaaaacaatagtcagaagattatcaaaaca
aaagcatcaaatttagttcatagcattaacttcatgtatattaacaaaaatcatgaatat
aatgtaagttcacaacgtgtcagaatccctaactttgaaaattcaacaatacaagacatt
caagtaccaatcgttttaagcgataatcaagcaaagactatagctgaaaatattctaaat
aaaaaatcaaacaataagtataatttttatcttacattaccaataaaatatgtttggctt
aatactaatgatataattcaagtagaatataatcatgttttatacaaaataaaaattata
aatatctacttagaaaatatctcaatcagtatagaaggagtactttacaatagttcatta
actactcaacatcttattcctgacaatgattttaacagttactctgataaatatattata
gaaaacccaatacatatatttgactttccatgtattcacaacatagacaatattctatac
ttcgcaatcaccagaattaaatcagtctgggaaggaagtattctatactcatatgaagat
caagatgaacactacaaaaacgttttatctatagatacagaagcaactactggaattact
attagtaatttaggcattggtccaattgctataccggatcaaacaaataaaataacaatt
ttcctcaagacaggacaattacattcaatcaaatccttatttatggataacagtagcaac
ctagcattaatcggagatgaaataattcaatttcaaaacgttaaacaaatcagagaaaat
atataccaactaagttatatgcttaggggaagatttggtacagaaagacacattgatcaa
catcacaaaaaagaactttttacattactagataatcttccttatctcaaaattaaccaa
tcactaataaataaatccttaatatataaggtagtacttaaaaaatctacatcttatgct
aaacaatcaacatacacatattacgcaaataacttaaaaccattacctgttacacatgtc
aaaggcaatcgtgatatatacaacaatctaacagtcaactgggtaagaagagcacgcatt
aatggagaatggaacgataatactgacacacctatagacgaaaaattcgaaagctatgat
attgagatttcagacaaccagaatatagtaaaacgtacaattacagtcaaagacagtaca
acatttgtatattctgcccaacaacagaaaatagattttaattcaatacaagagaaaata
aatgtgacaatataccaaaactcttacatcataggaagagggatagcttataaaactact
ttgtaa

DBGET integrated database retrieval system