KEGG   Ehrlichia chaffeensis Arkansas: ECH_0839Help
Entry
ECH_0839          CDS       T00328                                 

Definition
(GenBank) hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABD45550
UniProt: Q2GFZ8
Position
complement(857856..858020)
Genome map
AA seq 54 aa AA seqDB search
MFNLVNIIITTLKVMFGFISSSRKFLLIIYEDNVNVFLSYFKLDYRGISTYLWE
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaacttggttaatattataattactacgctaaaagttatgtttggatttataagt
agttctagaaaatttttgttaataatttatgaagataatgtaaatgtgtttttatcctat
tttaaattggattataggggtattagtacttatttgtgggagtaa

DBGET integrated database retrieval system