KEGG   Ehrlichia chaffeensis Arkansas: ECH_0843Help
Entry
ECH_0843          CDS       T00328                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ech00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    ECH_0843 (recR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ech03400]
    ECH_0843 (recR)
DNA repair and recombination proteins [BR:ech03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     ECH_0843 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ECH_0843 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR RuvX
Motif
Other DBs
NCBI-ProteinID: ABD44991
UniProt: Q2GFZ4
Position
complement(861489..862076)
Genome map
AA seq 195 aa AA seqDB search
MDINKLIAMFAKLPSFGPSSSRRIVLHLLRNKEEIMLPLASGIQDLAFQAKECPVCFNID
VKSPCSICSDTKRDHQLLCIVEELGDLWAFEKGKIYQGVYHVLGGTLSAIYGIGPDQLNL
DSIVERIKKFNVQEVIIGIGNTMDGQVTTHYITQMVKELGIKVTRLACGIPMGGEIDYLD
EGTLSAALSSRYIIS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtggatattaataagttaattgctatgtttgcaaaacttcctagttttgggccatcttct
tctagaagaattgtacttcatttacttcgtaacaaagaagaaattatgttgcctttagca
tcaggaattcaggatttagcgtttcaggctaaggagtgtcctgtatgttttaatatagat
gttaagtcaccatgtagcatttgttctgatactaaacgtgatcatcagttgttatgtata
gtagaagaactaggagatttatgggcatttgaaaaaggaaaaatatatcaaggtgtgtac
catgtattaggagggactttgtctgcaatttatgggataggacctgatcaattgaatttg
gatagtattgtagaaagaataaaaaaatttaatgtacaagaagtgattatagggatagga
aatactatggatggacaggttactactcattatataactcaaatggttaaggaactaggg
attaaggtaactagattagcttgtggtatacctatgggaggagaaatagattatttagac
gaagggactttaagtgcagctttatcatctcgatatattatatcttaa

DBGET integrated database retrieval system