KEGG   Ehrlichia chaffeensis Arkansas: ECH_0845Help
Entry
ECH_0845          CDS       T00328                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K02010  iron(III) transport system ATP-binding protein [EC:3.6.3.30]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech02010  ABC transporters
Module
ech_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:ech00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECH_0845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ech02000]
    ECH_0845
Enzymes [BR:ech01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.30  Fe3+-transporting ATPase
     ECH_0845
Transporters [BR:ech02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190] [OT]
    ECH_0845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase SMC_N AAA AAA_16 AAA_18 AAA_29 Rad17 ATP-synt_ab AAA_33 AAA_5 AAA_22 RNA_helicase AAA_15 AAA_23 G-alpha ATPase_2 NB-ARC HyaE AAA_14 Cytidylate_kin SbcCD_C AAA_28 AAA_30
Motif
Other DBs
NCBI-ProteinID: ABD45408
UniProt: Q2GFZ2
Position
complement(862510..863532)
Genome map
AA seq 340 aa AA seqDB search
MVGLQLNNVCYKYKKGQFLLHNISMSCKQGEVICLLGPSGCGKSTILKLIAGLENLHCGS
IYINNKILASSNFCMPTEERNVGLIFQHPSLFPHQTVIENVMFAVRNLPKIQKFNVALDI
LKSINMVAYKDMYPDMLSGGQQQLITIARAIAQKPEVILLDEPFSSLDTALRINIRRHVL
SLLKAKGITVLLVTHDPEEALEVADIIYVMRDGYIVQHGTPYEIYYSPKDHMLAQFFGEI
NRFVCTVKDSCIELPIGKIPAQSFTNGEKVVVCIRPEAIISDSDKGVKAVVKQIKFFNNM
ICVCVGDCLCWMRFANVVLPQVGDTIFILLDLNKILLFKV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggtaggtttacagttaaacaatgtctgttataaatataaaaaaggtcaatttttattg
cataatattagtatgagttgtaaacaaggagaagttatttgtcttcttggcccttctggg
tgtggtaagtctacaatactaaagttaattgctgggttggagaatttacattgtggttcc
atatatataaataataaaattttagctagcagtaacttttgtatgccaactgaagaacgt
aatgttggcttaatatttcagcatccttctttatttccacatcagactgttattgaaaat
gtaatgtttgctgttagaaatttgcctaaaatacagaagtttaatgttgcactagatata
ttaaaatctattaatatggtagcatataaagatatgtatcctgatatgctttctggagga
caacaacagttaattacaattgctagagcaattgctcagaaaccagaagtgatattgtta
gatgaaccattttctagtcttgatacagcattacggattaatattagaaggcatgtgtta
tcattattaaaagctaagggaattactgtattacttgttactcatgatccggaggaagca
ttagaagttgcagatataatatatgttatgcgtgatggatatatagttcagcatggtacc
ccatatgagatatattatagtcccaaagatcatatgttagcacagtttttcggtgagatt
aatcgttttgtttgtacagtgaaggattcttgtatagaattaccgatagggaaaatacca
gcacaatcttttactaatggagaaaaagtagtagtttgtataagacctgaggcaataatt
tctgattcagataaaggagtaaaagctgtagtaaaacagataaaattttttaataatatg
atctgtgtttgtgtaggtgattgtttgtgttggatgaggtttgctaatgtagttttacca
caagttggtgatactatatttatcttgcttgacttaaataaaattttattatttaaggta
tag

DBGET integrated database retrieval system