KEGG   Ehrlichia chaffeensis Arkansas: ECH_0846Help
Entry
ECH_0846          CDS       T00328                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbC
Motif
Other DBs
NCBI-ProteinID: ABD44779
UniProt: Q2GFZ1
Position
863840..864355
Genome map
AA seq 171 aa AA seqDB search
MFRFIVTILLTLFINTKCYSANLSNRVNMKLSIGSLDMKTKKIEAALQVTIQNGWHIYYK
TPGDLGLPTAFQWQDNTFKSIHVHWPKPLEHTDTVGDNTFHSNIYKDIVIFPISLVLKDN
KQKELNTTLRIRYAVCKDVCIPREKVIILNQLLQDYQNQQTMQLINFWKTK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtttagattcatagtcacaattttactaacattatttatcaatacaaagtgctactct
gcaaatctttcaaatcgagttaacatgaaactatctataggatcattagacatgaaaacc
aaaaaaattgaagcagctcttcaagtgacaatacaaaatggttggcatatttattacaaa
acacctggagatcttggtttaccaacagcttttcaatggcaagacaacacatttaagagc
atacatgtacattggcccaaaccattagaacatacagatactgtaggtgacaacacattt
catagtaatatctataaagatattgtaatatttcccatatcattagtactcaaagataac
aaacaaaaagaattaaataccactttacgcattagatatgctgtatgcaaagacgtatgt
atacctagagaaaaggtaattatattgaaccaacttttacaggattatcaaaaccaacaa
actatgcagttaattaacttctggaaaactaaataa

DBGET integrated database retrieval system