KEGG   Ehrlichia chaffeensis Arkansas: ECH_0848Help
Entry
ECH_0848          CDS       T00328                                 

Definition
(GenBank) biotin--acetyl-CoA-carboxylase ligase
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00780  Biotin metabolism
ech01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ech00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ECH_0848
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ech03000]
    ECH_0848
Enzymes [BR:ech01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     ECH_0848
Transcription factors [BR:ech03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    ECH_0848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C BPL_LplA_LipB_2 MKT1_N
Motif
Other DBs
NCBI-ProteinID: ABD45302
UniProt: Q2GFY9
Position
866128..866883
Genome map
AA seq 251 aa AA seqDB search
MKLNLSNINLPNGYTLEHHKILYSTNYEAIKLAECGAEDGTIIISDKQIKGRGRYERTWY
SPTGNLYFSIIITKFKETFPLPFIAALSVGKTLEEILINNNNTTSKVEYKWPNDILVNSK
KISGILLESKTLNNTLQKWIVVGIGINMYKAPTYATTIKEHNQNFTLSNLELLEKVINNF
YNFRKHYIYHGFADIRNLWLKQTCHLNREITVKSYKHTYTGQFITIDTQGNMLMKQNDKT
ICITSGEIFNI
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaaacctatctaatataaatctaccaaacggatatactttagaacatcacaaa
attttatatagtacaaattacgaagcaatcaaacttgcagaatgcggagctgaagatggt
acaataatcatatccgataaacaaattaaaggtagaggaagatatgagcgcacatggtac
tcccccacaggcaatttatatttcagtattattataacaaaattcaaagaaacgttccct
ttaccatttattgcagcattatctgttggaaaaacactggaagaaatattaataaataac
aacaacacaacatcaaaagtagaatataaatggcccaatgatatattagtaaatagtaaa
aaaatatcaggtatattgttagaaagtaaaacattgaataacacactacaaaaatggata
gtagtcggcataggcatcaatatgtataaagcaccaacatatgcaacaacaatcaaggag
cataatcaaaatttcaccctatctaacttagaattactggaaaaagtaataaataatttt
tacaacttcagaaagcattatatttatcacgggtttgcagatataaggaacctatggctc
aaacaaacatgtcatttaaacagagaaataactgttaaaagctacaaacacacttacact
ggtcaattcattacaatagatacacaaggtaacatgttaatgaaacaaaacgataaaaca
atatgcatcacctcaggagaaatatttaatatctaa

DBGET integrated database retrieval system