KEGG   Ehrlichia chaffeensis Arkansas: ECH_0858Help
Entry
ECH_0858          CDS       T00328                                 

Gene name
gyrA
Definition
(GenBank) DNA gyrase, A subunit
  KO
K02469  DNA gyrase subunit A [EC:5.99.1.3]
Organism
ech  Ehrlichia chaffeensis Arkansas
Brite
KEGG Orthology (KO) [BR:ech00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ech03032]
    ECH_0858 (gyrA)
   03400 DNA repair and recombination proteins [BR:ech03400]
    ECH_0858 (gyrA)
Enzymes [BR:ech01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     ECH_0858 (gyrA)
DNA replication proteins [BR:ech03032]
 Prokaryotic Type
  DNA Topoisomerases
   ECH_0858 (gyrA)
DNA repair and recombination proteins [BR:ech03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      ECH_0858 (gyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C
Motif
Other DBs
NCBI-ProteinID: ABD44722
UniProt: Q2GFY0
Position
complement(878326..881022)
Genome map
AA seq 898 aa AA seqDB search
MSDVNNVIPVSIEQELEDSYLSYAMSVIVSRAIPDIRDGLKPVHRRILYSMYKSGYDYGK
PYKKAARVVGDVMGKYHPHADAAIYDSLVRMAQDFSLLLPLIDSQGNFGSIDGDPPASMR
YTEARLAKAAHFLLNDIDEDTVDFRPNYDENEVEPVVLPAEFPNILVNGAGGVAVGMSTN
IPSHNLGEVIDACIAYIDNPEITFDELINIVRGPDFPTGGTILGDAGIRSAFMTGKGTII
IQGKTHLEDLPSGKQAIIIDEIPYQVNKAKLIERIHELIKEKKIEGILDLRDESNKMGIR
VAIELKKQVSHQVILNQILGLTPLRTSFSINTLVLDNNKPKVMSLPDIISTFVEYRKEVL
TRRTQFRLRKVRERAHLYIGMYIAVLNIDKVIAIIRSSRDTAEATKRLLECKWDALTSVR
EMIELVADSKSIVIDNVCQLTGVQVKSILEMKLQRLTNLEKEKLELDLKSMVSMIKQYTE
LLKNKESLLQLIKDGFKEIKAKLAVPRRTTIDYSHFETDIEDLIPKEDMVVTVTMSGYIK
RAKLSNYRAQKRGGKGRIGQAIKEEDVITNLFVVNTHTSVLFFSNIGRVYKLKVYKLPLG
EPTSRGRSLVNIFPLSENESITSVMPLPDNVEDAEILNIVFATASGNLRRNALSDFQYVP
SNGKIAMVLDTGDTLISVKVCKEEDHVLLSTRLGKSIRFSVSNVRQFKGRMSDGVRAIKL
SSDDNVISMSVLLAMDIDSEKKDLYLKVPLDKRMCVKEEGVVNGGIAKILCDLGLEQDIF
VTMVQNEQFILTVTENGFGKRTSAYEYRTTLRGGVGVVNILTTARNGNVVASFPVESNDH
IMLITDKGKLIRIAVSDIRIIGRSTQGVTLFKTEKREKVVSVAKIIDAKDNSDIDGNI
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgtcaataatgtcataccggtttctatagaacaagaattagaagattcttac
ttatcttacgcaatgagcgttatagttagtagggcgattcctgatatacgagatggatta
aaacctgtgcatagaaggattttgtattctatgtataagtctggttatgattatggtaag
ccgtataaaaaagcagcacgtgttgttggtgatgttatggggaaatatcatcctcatgca
gatgcggcaatttatgattcattagtaagaatggcgcaggatttttctttgctattgccg
ttaattgatagtcagggtaattttggttcaatagatggtgatcctccagcttctatgcgt
tatacagaagctagattggcgaaggcagcacattttttattaaatgacatagatgaagat
actgtagattttcggcctaattatgatgagaatgaagtagagcctgtagtattaccagca
gaatttcctaatatactggttaatggagctggtggtgttgctgttggtatgtcaaccaat
attccttctcacaatttaggggaagtaatagatgcttgtatagcttacatagataatcct
gaaattacttttgatgagttaattaatatagttcgtggtcctgattttcctactggtggt
actattttaggggatgctggtatacgttctgcatttatgacaggtaaaggaacaattatt
attcaggggaaaactcatttagaagatttaccgtctggaaagcaagcaataattattgat
gaaattccttatcaggtaaataaggcaaaacttattgagcgtatccatgaactgatcaaa
gaaaaaaagatagaagggatattagatttacgagatgaatctaacaaaatggggatacga
gttgcaattgaattaaagaaacaggtgtctcatcaggttatcttaaatcaaattttagga
ttaactccattgagaacgagctttagtattaatacgcttgtattagataataataaacca
aaagtgatgtctttaccagacattatatctacgtttgttgagtatagaaaggaagtttta
acacgtcgtacccagtttagattaagaaaggttcgggaaagagctcatttatatataggc
atgtacattgctgtgttaaatattgacaaagttattgctattattagatcatctcgtgac
acagcagaggctactaagcggttacttgaatgtaagtgggatgctctaacatctgttaga
gagatgatagaacttgttgccgatagtaaaagcattgtcattgacaatgtatgtcaatta
acaggtgtacaagtaaaatcgatactggaaatgaaattacagcgtctcacaaacctggaa
aaggaaaaattggaacttgacttaaagtcaatggtatcgatgattaaacagtatactgag
cttcttaaaaacaaagagtctttattacaattgattaaggatgggtttaaagagattaaa
gcaaaattagctgttcctaggagaactactatagattattcacattttgagaccgatatt
gaagatcttataccaaaagaagatatggtagttactgtcactatgagtggttatattaaa
cgtgctaagctttcaaattatcgagctcagaaaagaggtggaaaggggagaataggacag
gctattaaggaagaagatgtaataactaatctttttgtagttaatactcatactagtgta
ttgttcttttctaatattggtagagtatataagttgaaggtttataagcttccattaggt
gaacctacatcacgtggaagatcattagtaaatatttttccgctgagtgagaatgaatct
ataactagtgttatgcctttacctgataatgtagaagatgcggaaatattgaatattgtt
tttgcaactgcatcaggtaatttaagacgtaatgcactttcagattttcaatatgtacct
agtaacggtaaaatagctatggtacttgatacaggagatactttgatatctgtgaaggta
tgtaaggaagaggatcatgttttattgtctacaaggttagggaaaagtattaggttttct
gtaagtaatgttcgtcagtttaagggcagaatgtctgatggggtaagagctattaagcta
tcttcagatgataatgtcatttctatgtctgtattgctagctatggatatagattctgag
aaaaaggatctgtatttaaaagttcctttagacaagcgtatgtgtgttaaagaggaaggt
gttgttaatggaggtatagctaagatattatgtgatcttggattagaacaagacatattt
gttactatggtacaaaatgaacaatttattttaacagtaactgaaaatggctttggaaaa
agaacttctgcatatgaatatcgcactactttgagagggggagtaggtgttgttaatatt
ttgacaactgcaaggaatggcaatgtggtagctagttttcctgtagaatctaatgatcat
ataatgttaattacagataaaggtaagctaattcgtattgctgtaagtgatatcagaatt
attggtagaagtactcaaggtgttactttatttaagactgagaaacgtgaaaaagttgtt
tcagtagcaaagataattgatgctaaggataattctgatattgatggtaatatataa

DBGET integrated database retrieval system