KEGG   Ehrlichia chaffeensis Arkansas: ECH_0872Help
Entry
ECH_0872          CDS       T00328                                 

Gene name
trmU
Definition
(GenBank) tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
  KO
K00566  tRNA-uridine 2-sulfurtransferase [EC:2.8.1.13]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ech00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    ECH_0872 (trmU)
Enzymes [BR:ech01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.13  tRNA-uridine 2-sulfurtransferase
     ECH_0872 (trmU)
Transfer RNA biogenesis [BR:ech03016]
 Prokaryotic Type
  tRNA modification factors
   Thiolation factors
    ECH_0872 (trmU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_Me_trans NAD_synthase QueC Asn_synthase PAPS_reduct ThiI ATP_bind_3
Motif
Other DBs
NCBI-ProteinID: ABD44578
UniProt: Q2GFW6
Position
891637..892740
Genome map
AA seq 367 aa AA seqDB search
MLNDFKIDPLVKNKSPSATTAVVAMSGGVDSSVAAALLHKLGYKVIGITLQLYNNTTGKG
ACCGSLDTQDAKQVASIMGFPHYTLNYEKVFKEEVIDDFIDTYMQGKTPIPCIKCNQVVK
FRDLLNATKSLDADILVTGHYIRKIEQDDDIYVYSSKDTKKDQSYFLFATTIEQLKFLRF
PLGNFHKDNIRKLAEHFNLPIANKPDSQNICFVADTYKNTIAQLRPNAIKKGNIIDTSGN
ILGQHDGIVNFTIGQRRGIGLSSKEPLYVIKLNPDTNEVTVGHKSALLQNKLHIEKINWL
VKDKIPHTGLNVKVKLRSSHSGSTAIVYPNDNNKATVLLQDTYCTVTPGQACVIYDGDRM
LGGGWIC
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgactttaaaatagacccactagttaaaaataaatcaccctcagcaacaact
gcagttgttgctatgtccggcggtgttgatagttcagtagcagcagcattgttacacaaa
ttagggtacaaagttatcggcatcactctacaactatataataatactactggaaaaggt
gcatgctgtggtagtctggatacgcaagatgcaaaacaagtagcatcaattatggggttc
cctcattatactctcaactatgaaaaagtatttaaagaagaagtcatagatgattttata
gacacatacatgcagggcaaaactcctataccatgtataaaatgcaatcaagttgtaaaa
tttagagatctacttaatgcaacaaaatcacttgatgcagatatcctagttaccggtcat
tatattagaaaaatagaacaagatgatgatatatacgtatattcaagcaaagatacaaaa
aaagatcagagttattttctatttgcaactacaatagaacagctaaaatttcttagattc
ccactaggaaattttcataaagataacataagaaaattagcagaacattttaatctacca
atagcgaataaaccagatagccaaaatatatgtttcgttgcagatacatataaaaataca
atagcacaactaagacctaacgcaataaaaaaaggtaatattatagatactagtggaaac
atattgggacaacatgatggtatagtcaattttactattggacaaagaagaggtatagga
ttatcttcaaaggaaccattatatgttatcaaattaaatccagatactaatgaagttaca
gtgggccacaaatctgcactattgcaaaataagctacacatagaaaaaataaattggtta
gttaaggacaaaattccacacactggactaaatgttaaagtaaaactaagatcatcccat
tcaggtagcacagctatagtttatccaaacgataacaataaagcaactgtactattacaa
gacacatattgcacagtaactcctggacaagcatgtgttatttatgacggagatagaatg
ttaggaggaggatggatatgttaa

DBGET integrated database retrieval system