KEGG   Ehrlichia chaffeensis Arkansas: ECH_0873Help
Entry
ECH_0873          CDS       T00328                                 

Definition
(GenBank) Coq7 family protein
  KO
K06134  3-demethoxyubiquinol 3-hydroxylase [EC:1.14.99.60]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00130  Ubiquinone and other terpenoid-quinone biosynthesis
ech01100  Metabolic pathways
ech01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ech00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ECH_0873
Enzymes [BR:ech01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.60  3-demethoxyubiquinol 3-hydroxylase
     ECH_0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COQ7 Ferritin_2
Motif
Other DBs
NCBI-ProteinID: ABD45198
UniProt: Q2GFW5
Position
complement(893383..893895)
Genome map
AA seq 170 aa AA seqDB search
MLQKDNLLQQAIRVNHAGEYGAVCIYSGQELIFRKMSVGEKILEMKKQEQKHFRYFDSVM
KDKKIRPTVFLPVWHVMGVMLGITTALMGEDAAMACTVAVEDVISDHYQDQIAMLDEGEL
KDKVIQFRNEELEHHDTAMCYNSGNAANYSILSFFIKKACKAAICLSKVM
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaaaagataatctattgcaacaagctattcgagtaaatcatgctggagagtat
ggagcagtgtgtatatattctggtcaagaattgatttttcgtaaaatgtctgttggtgag
aaaattcttgaaatgaagaaacaagaacagaagcattttcgttattttgattctgtaatg
aaagataaaaaaatacgtcctacagtttttttaccagtatggcatgttatgggagttatg
ttaggtattacaacggctttaatgggtgaggatgcagctatggcttgtactgttgctgtg
gaagatgtaataagtgatcattatcaagatcaaatagcaatgttggatgaaggtgaatta
aaagataaggttattcagtttcgtaatgaagagctggaacatcatgatactgctatgtgt
tataattctggtaatgctgctaactatagtatcttgtctttttttataaaaaaggcatgc
aaagctgctatctgtctttctaaagttatgtga

DBGET integrated database retrieval system