KEGG   Ehrlichia chaffeensis Arkansas: ECH_0874Help
Entry
ECH_0874          CDS       T00328                                 

Definition
(GenBank) disulfide bond formation family protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbB DUF5325
Motif
Other DBs
NCBI-ProteinID: ABD44712
UniProt: Q2GFW4
Position
complement(893879..894352)
Genome map
AA seq 157 aa AA seqDB search
MVKNYSVILLFIASIVALGVAYIAQYLFGMLPCKLCIYERIPYFITVGLFILYLFKSSKV
IFFIMCLCYICNICISGYHVALEHSWVADIIGCTDSIKSLNFDDLKNALLDVNVVISCNR
PSIVFIGLSMAECNLIYCVLCLVLSVYLFVKQYVTKR
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaattacagtgtaattttgttatttatagcaagtattgttgcattgggtgta
gcctatatagctcaatatttgtttggaatgcttccttgtaagttatgtatatatgaacgc
ataccatattttattactgttggattgtttatcttatatttatttaaatcatctaaagta
attttttttataatgtgcttatgttatatatgcaatatatgcatctcaggttatcatgtt
gctcttgaacatagttgggtagcggatattataggatgtacagatagtataaaatcttta
aattttgatgacctgaaaaatgctttactagatgtaaatgtggtaatatcttgtaatcgt
cctagtattgtatttataggattatctatggcagaatgcaatcttatatattgtgtgcta
tgtttagtattaagtgtctatttatttgtaaaacaatatgttacaaaaagataa

DBGET integrated database retrieval system