KEGG   Ehrlichia chaffeensis Arkansas: ECH_0880Help
Entry
ECH_0880          CDS       T00328                                 

Definition
(GenBank) hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABD45532
UniProt: Q2GFV8
Position
903176..903334
Genome map
AA seq 52 aa AA seqDB search
MVFVSINKPLQKSYPTKLLMIIVNLILRMLRLCLRHSFFASLLFNDVYNFNF
NT seq 159 nt NT seq  +upstreamnt  +downstreamnt
atggtttttgtttcaattaataaaccactacagaaatcttaccctactaagcttttaatg
attattgtaaatttaatattgcgtatgttaaggttgtgtttacggcattcgttttttgca
agcttattatttaatgatgtgtataatttcaatttttaa

DBGET integrated database retrieval system