KEGG   Ehrlichia chaffeensis Arkansas: ECH_0885Help
Entry
ECH_0885          CDS       T00328                                 

Definition
(GenBank) sensor histidine kinase
  KO
K07716  two-component system, cell cycle sensor histidine kinase PleC [EC:2.7.13.3]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ech00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECH_0885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ech01001]
    ECH_0885
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ech02022]
    ECH_0885
Enzymes [BR:ech01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ECH_0885
Protein kinases [BR:ech01001]
 Histidine kinases
  Cell cycle family [OT]
   ECH_0885
Two-component system [BR:ech02022]
 Cell cycle family
  PleC-PleD [MD:M00511]
   ECH_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_3 Nucleoside_tran DUF3169 Vpu PspB DUF5385 Tetraspannin UPF0542 Shisa ASFV_J13L DUF3139
Motif
Other DBs
NCBI-ProteinID: ABD45343
UniProt: Q2GFV3
Position
complement(909209..910621)
Genome map
AA seq 470 aa AA seqDB search
MKYFRILLLMFLVMTLCFAVGYTHIYLRDDYLYEVSKEINVNIKAILVNSVINKYAQLLA
KAPSHVSTNTYYMNLLIKLRAEFLKALGGVKDFHVILYNVDGNVIFSNRSSEDIADQDLL
LRSEDMNSLLRGKYVDHRVSNGATTVSIFPIFSLDGQDSSPLMFLKIIKNSENLSSFIVN
FYTVFLMIVILVIIIFIVVTWCIYYKNAKMLSKQYNANLKLKEAKEVAEQENVSKSQFLA
NVSHELRTPLNSIIGFSEMMKAESMGAIENVHYKEYINDIHNAGVHLLSLINDILDFSKA
EADKLVVEFVKFDLGKVISSCFNMILPRAEEAKVRLEQVLPSNQIIMVADPKRMKQVIIN
LLSNSIKFTPENGCVKLVVEYDLENSMIVIEVIDNGIGIAQQDLYKVMSVFGQVDSRHAR
KYEGTGLGLPLSKKLVELMDGVFKIKSEPNLGTIVTLMFPYTNTLEEKGF
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattttcgaattttattgttaatgtttttagtaatgactttgtgctttgcagtt
ggttatacgcatatatatttgagggatgattatctgtatgaagtttcaaaagaaatcaat
gtcaatattaaagcaatacttgttaattctgtgatcaataaatatgctcaattattagca
aaggctccaagtcatgtatcaacaaatacgtactatatgaatttgttgataaagttacgt
gctgaatttctcaaagctttaggtggggttaaagattttcatgttattttatataatgta
gatggaaatgtaatattttctaatagaagtagtgaagatattgcagatcaggacctgctg
ttacgttctgaagatatgaattcattattaagaggaaaatatgtagaccatagagtaagt
aatggagcaactactgtgtctatatttcctatattttcattagatggtcaagatagttct
cctttaatgtttttaaagataattaaaaattcagaaaatttatccagttttattgtaaat
ttctatactgtgtttttaatgatagtcatattagtcattattatatttattgttgtaact
tggtgtatatattataaaaatgcaaaaatgctaagtaagcagtataacgcaaatctaaaa
ttaaaagaagcaaaggaagtagcagaacaagagaatgtaagtaaatcacaatttcttgca
aatgttagtcatgagttacgtactccattgaactctattattgggttttcggaaatgatg
aaggctgagtccatgggggctatagagaatgttcattataaggagtatataaatgatatt
cacaatgctggtgtccatctattaagcttaattaatgatattttagatttctctaaggct
gaggctgataaattagttgtagaatttgtaaaatttgatttaggaaaagttatttcttcc
tgctttaatatgatacttccaagagctgaggaagcaaaagtaagacttgaacaagtatta
ccatctaatcaaattataatggttgcagatcctaaaagaatgaaacaagttatcatcaac
ttattatccaattcaataaaatttactcctgaaaatggatgtgtaaaattagtggtagaa
tatgatctcgaaaatagcatgattgttattgaagttattgataatggtataggtatagca
cagcaagatttgtataaggttatgtctgtttttgggcaggtagatagtagacatgctcgt
aaatatgaaggtacagggttaggtttacctttaagtaagaaattagttgaactgatggat
ggggtatttaaaataaagagtgaacctaatttaggtactatagtaaccttaatgttcccg
tatactaatacccttgaagaaaaaggcttctaa

DBGET integrated database retrieval system