KEGG   Ehrlichia chaffeensis Arkansas: ECH_0886Help
Entry
ECH_0886          CDS       T00328                                 

Gene name
argD
Definition
(GenBank) acetylornithine/succinyldiaminopimelate aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00220  Arginine biosynthesis
ech00300  Lysine biosynthesis
ech01100  Metabolic pathways
ech01110  Biosynthesis of secondary metabolites
ech01120  Microbial metabolism in diverse environments
ech01130  Biosynthesis of antibiotics
ech01210  2-Oxocarboxylic acid metabolism
ech01230  Biosynthesis of amino acids
Module
ech_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
ech_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ech00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    ECH_0886 (argD)
   00220 Arginine biosynthesis
    ECH_0886 (argD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ech01007]
    ECH_0886 (argD)
Enzymes [BR:ech01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     ECH_0886 (argD)
    2.6.1.17  succinyldiaminopimelate transaminase
     ECH_0886 (argD)
Amino acid related enzymes [BR:ech01007]
 Aminotransferase (transaminase)
  Class III
   ECH_0886 (argD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABD45332
UniProt: Q2GFV2
Position
910768..911946
Genome map
AA seq 392 aa AA seqDB search
MNSSPILPVYAPSKVTFSHGKGVYLYDYNNKKYVDFHAGIATSSLGHAHPALVNALKTQG
EKLWHISNVHTIPEAIKLAQKLVDISFADKVFFNNSGAESVECCLKIARSYQCGKGNTQR
YRFITMKQSYHGRTCAACSANDPSKFSPFLKPYVEWFDCVNPDITSIKNAINETIGAILL
EPIQGEGGINVLDDSFLKELRTICDQNDILLIFDCVQCGSGRTGKFFAHEHTGVTPDICC
LAKGLGGGFPISATLATNNASQFMGVGMHGSTFGGNPLATTIGMTVVEEILKDGFLDNVT
KNGHYLYKRLEDLAKKFPVIEEVKGKGLMIGLKINTNINNRELMHDLISCGLLTNTASNN
TLRIVPPLIITQQEIDEGLAILESYLQSKYHQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatagttcgccaattttacctgtttatgcaccatctaaggttactttctcacatggg
aaaggagtctatttatacgactataataataaaaaatatgtagattttcatgcaggcatt
gcaactagttcgttaggacacgctcatccagcattagtaaatgcattaaaaacacaaggt
gaaaagttatggcacatatcaaatgtacatacaatacctgaagctatcaagttagcacaa
aaattagtagatattagcttcgctgataaagtgttttttaataattcaggtgcagaatct
gtagaatgttgcttaaagatagcaaggtcataccaatgtggtaaaggtaatactcaacgt
tatagattcattacaatgaagcagtcttatcatggaagaacatgtgctgcatgttcagca
aatgatccaagtaaattctctccatttcttaaaccatacgttgaatggtttgactgtgta
aatcctgatatcacatccataaaaaatgcaattaatgaaactataggtgctatactatta
gaacctatacaaggagaaggaggaatcaacgtacttgatgattctttcttgaaagaatta
cgtacaatttgtgatcaaaacgatatactgctaattttcgattgtgtacaatgtggaagt
ggaagaacaggaaaattctttgctcatgagcatactggagtaactcctgacatatgttgt
cttgcaaaaggattaggtggtggtttccctatatcagcaactttagcaaccaataatgct
tctcagtttatgggtgttggcatgcatggttctacttttggaggaaatcctttagcaact
actattggaatgactgtagttgaagaaattttaaaagatgggtttttagacaatgtaact
aaaaatggccattatctgtacaaaaggttggaagatttagctaaaaaatttccagtaatt
gaagaagtaaaaggtaaagggctcatgataggactaaaaatcaatactaatattaataat
agagaattaatgcatgatttaataagttgtgggttactaaccaacactgcaagcaataat
actttaaggatagtacctcctttaatcataactcaacaagaaattgatgaaggtcttgct
atactagaaagttatctgcaaagcaaatatcatcagtaa

DBGET integrated database retrieval system