KEGG   Ehrlichia chaffeensis Arkansas: ECH_0887Help
Entry
ECH_0887          CDS       T00328                                 

Definition
(GenBank) hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABD44584
UniProt: Q2GFV1
Position
912555..912674
Genome map
AA seq 39 aa AA seqDB search
MLSVSTSVKAIVLSLLSIGFPLFTIVVDSFVAYYKNTKQ
NT seq 120 nt NT seq  +upstreamnt  +downstreamnt
ttgttatctgttagcacaagtgttaaagctatagtattaagtttgctatcaattggattt
ccattatttactatagtagtagatagttttgtagcctattacaagaatacaaaacaatag

DBGET integrated database retrieval system