KEGG   Ehrlichia chaffeensis Arkansas: ECH_0888Help
Entry
ECH_0888          CDS       T00328                                 

Definition
(GenBank) putative membrane protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2897 ArsP_2
Motif
Other DBs
NCBI-ProteinID: ABD45159
UniProt: Q2GFV0
Position
912875..914020
Genome map
AA seq 381 aa AA seqDB search
MVLLKHTFVLYTTQWLFHLLFKLTWYRAMIVGQNNQGGSCAGSDEYQPLNTDPLPNDDTS
TVEYNEFSPLLRSEEDETPDKANDEILNKIDFDRYFVIFSFIGLLAEAASSIFNLVSTQV
FIPTSTKHAVATAFYALCILIAISMIVSSILAIKKSLNQKKHLDDMPTDASNEECVEENA
KYKKLKKIQAHAQVSENALTIISQVMWLIVYIASLVMISMGDNQILENMSLFLSITASLL
GIISCVIRLIDANISRKTSGSEEEKKQHLSFTIFCGIILAFEIIHCACHISEAISLGGKM
HNLYDFQNIPILCFELITVAMFIASFFIEQCIKSKGGKHQTNDDGVAAAACCGDNLHPSS
LLADDSGGNIARLIVAQELSA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggtactattaaagcacacttttgtgttgtacaccactcagtggctatttcatctactt
tttaagttaacatggtacagggctatgatagtaggacaaaacaatcaagggggttcttgc
gcaggatcagatgaatatcaaccactaaacacagatccacttccaaatgacgatacatca
acagtagaatataatgagttttcccctctattaaggtcagaagaagatgaaacaccagat
aaggcaaatgatgaaatactgaataagatagattttgatagatattttgtaattttttct
ttcattgggttattagcagaagcagcgtcttctatattcaatttagtatcaacccaagtt
tttattcctactagcactaaacatgcagtagctactgctttttatgctctctgtatacta
attgcaatttccatgattgtaagttcaatacttgcaataaagaaatcactcaaccaaaaa
aagcatcttgacgatatgccaacagatgcatcaaatgaagaatgtgtagaagagaacgcc
aaatataaaaaattaaaaaaaatacaggctcatgctcaagtttctgaaaatgctcttact
atcatttcacaggtgatgtggcttattgtttatattgcatcactagtaatgatatctatg
ggtgacaaccaaatacttgaaaacatgagcctgtttttatcgattactgcatctctttta
ggtattatatcttgtgttataaggttaatagatgcaaatatatcacgtaagacatctggt
tctgaggaagaaaaaaaacaacaccttagtttcacaattttttgcggtatcatcttagct
tttgagataattcattgtgcatgccatatatcagaagcaatatctcttggtggaaaaatg
cacaatctttatgactttcagaatattcctatactctgtttcgaactgataacagtagct
atgtttattgcatcattcttcatagaacagtgcattaaaagtaaaggaggaaagcaccag
accaatgatgatggtgttgccgctgccgcttgttgcggtgataatctccatcctagtagc
ttattagctgatgatagtggtggtaatattgccagacttatagtagcacaagaactatca
gcttaa

DBGET integrated database retrieval system