KEGG   Ehrlichia chaffeensis Arkansas: ECH_0890Help
Entry
ECH_0890          CDS       T00328                                 

Definition
(GenBank) putative cell division protein FtsK
  KO
K03466  DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
ech  Ehrlichia chaffeensis Arkansas
Brite
KEGG Orthology (KO) [BR:ech00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ech03036]
    ECH_0890
Chromosome and associated proteins [BR:ech03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    ECH_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE Ftsk_gamma FtsK_4TM AAA_10 T2SSE DUF87 TrwB_AAD_bind DEAD AAA_22 AAA_29 AAA_19
Motif
Other DBs
NCBI-ProteinID: ABD44495
UniProt: Q2GFU8
Position
complement(914420..916903)
Genome map
AA seq 827 aa AA seqDB search
MLCVTILGKIVVSIKSVLNKTFVSFKIFLLSFVVAFVSLSILTYHENDLSFNLATDSPVR
NLGGVVGSHLADIFVQIFGISSLIAIPLMVFCVVNILCRVNRNIYLYLGSSLMIMVGISG
LVSNVSLKVIHKYYYGGVLGIYFQSCPIIVLLAIVLLGTAGIIGWKKIVYLYDILLKMFS
RIIHKSNNISDTVIREEISQNVGQAQEYYNIEDSLDEREFTEEEEEIEEDELTKELIEEE
IEEEESIEEFMEEEVEGEELAEELDFPDEEEGLEFQVEEDDDECEEEDEESNYDEECHDK
YDDKDDYIDDSNEKEIVVYKRPQATPQVVQEKKKYKEFVLPSVDYLSKPNPVDKREFHPD
DNVVNLLNKVLKDFSIHGNIVNIRYGPVVTLYEFEPSAGTKSSRVIGLSDDIARSMSALS
TRISVIPGRNVMGIELPNHYREIVMLRDLFESEQYRDSRLKLPIALGKGIDGEVVIADLV
KMPHLLIAGTTGSGKSVAINTMILSLIYSLTPDQCKMIMIDPKVLELSVYNSIPHLLTPV
VTESKKAIAALKWVVSEMENRYRLMSDIGVRNIVSYNDKIKEAIDENRTLEKVLQTGFDK
ETGEAIFERIAIEPSVFPYIVVIVDEMADLMLVAGKEIESSIQRLSQMARAAGIHIIMAT
QRPSVDIITGVVKANFPTRISFAVTSKIDSRTILGEQGAEQLLGMGDMLYMVSGGRIIRV
HGAFVSDDEIQNIVEYLRSQGTPDYIEGITRIQQDYDYCIDDNIPERDDELYKQAVSIVI
RDRRTSISYIQRQLRIGYNRAANLVERMERDGVIGVASAGKREILLE
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgctttgcgttactattttgggtaagatagttgtgagtataaaatctgtccttaataaa
acttttgtttcctttaagatatttttactatcttttgtggtagcatttgtttctttgtca
attcttacttatcatgaaaatgatttatctttcaatctggcgactgactctcctgtgaga
aatttaggtggcgttgttgggtcgcatctagctgatatttttgtacaaatatttggtata
tctagccttatagcaattcctttaatggtcttttgcgttgttaatatactatgtcgtgtc
aataggaatatttacctgtaccttggtagcagtttgatgattatggttggaataagtgga
ttggtatcgaatgtttctctaaaggtcatccataaatactattatggtggtgttctaggt
atctattttcaaagctgtccaattattgtattgcttgctatagtattgttgggtactgct
ggaattattggttggaaaaaaattgtatatctttatgatatcttattaaaaatgtttagt
aggataattcataaatctaacaatattagtgatactgttataagagaagaaatctctcaa
aatgtaggacaagctcaagagtattataatatagaagattcattggatgagagagaattt
acagaggaagaagaggaaatagaggaagacgaattaacgaaagagttaatagaagaagaa
atagaagaggaagaatcaatagaagagtttatggaagaggaggtggaaggagaggaatta
gcagaagaattagattttccagatgaagaagaagggttagaatttcaagttgaagaagat
gatgatgaatgtgaagaagaagatgaggaaagtaattacgatgaagaatgtcatgataaa
tatgatgataaagacgattatattgatgacagtaatgaaaaagagatagtagtttataag
agacctcaggcaactcctcaagtagttcaagaaaaaaaaaagtataaagaatttgtccta
cctagtgttgattatttatcaaaacctaatccagtagataaaagagagtttcatccagat
gataatgttgtcaatttgcttaataaagtacttaaggatttttctatacatggaaacata
gttaatattaggtatggtccagtagtaacattatatgagtttgaaccatctgctggtact
aaatcatcaagggttataggattgtctgatgatattgctcgttcaatgagtgctttgtca
acacgtatatcagttattcctggaagaaatgttatgggtatagaactaccaaatcactat
agggaaatagtgatgttacgtgatttatttgaaagtgaacagtatagggattctaggctt
aaattacccatagctttaggaaagggtatagatggggaagtagttattgctgatttagta
aaaatgccgcatcttcttattgctggtactacagggtctggaaaatctgtagcaattaat
actatgattttatctctgatctacagtttaactccagatcaatgcaaaatgattatgatt
gatcctaaagtactagaattgtcagtctataattctattccacatttgttaactccagta
gtgactgaatccaaaaaggctattgctgctttaaagtgggtagtaagtgaaatggaaaat
cgttaccggttaatgtctgatattggagtacgtaatattgttagttataatgataaaatt
aaagaagcaattgatgagaatagaactctagaaaaagtattacagacagggtttgataaa
gagacaggggaggcaattttcgaaagaattgcaatagagcctagtgtttttccttacatt
gtagtgatagtagatgaaatggcagatttaatgcttgtagctgggaaagaaattgaatct
tcgatacaaagattatctcagatggcaagggctgctggaattcatataattatggcaact
cagcgtccttctgttgatataatcacaggggtagtaaaagcaaatttcccaacaagaatt
agctttgccgtaacatcgaagatagatagtagaactatccttggtgaacaaggagcagag
cagttacttggtatgggtgacatgctgtatatggtatctggtggtagaataatacgtgtg
catggagcttttgttagcgatgatgaaatacagaatatagttgaatatttgaggtctcaa
ggaactccagattatatagaaggtattacacggatccaacaagattatgattattgtata
gatgataatattcctgaacgggatgatgaattgtataaacaagcagtgtcgatagtaata
agggatcgaagaacttctattagctatatccagagacaattaagaataggatataataga
gctgcaaatttagtagagcgtatggaaagagatggtgttattggagttgcaagtgctgga
aagcgagaaatattgcttgaatag

DBGET integrated database retrieval system