KEGG   Ehrlichia chaffeensis Arkansas: ECH_0893Help
Entry
ECH_0893          CDS       T00328                                 

Gene name
thiE
Definition
(GenBank) thiamine-phosphate pyrophosphorylase
  KO
K00788  thiamine-phosphate pyrophosphorylase [EC:2.5.1.3]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00730  Thiamine metabolism
ech01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ech00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ECH_0893 (thiE)
Enzymes [BR:ech01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.3  thiamine phosphate synthase
     ECH_0893 (thiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ABD44828
UniProt: Q2GFU5
Position
complement(918668..919402)
Genome map
AA seq 244 aa AA seqDB search
MQKDALIIARASANQSVEDASFLDERYFPIITLNKDYYFDKNFHPMLDPVGFYQIVPDLF
WLKYVINLGVKVVQLRIKNEPIEEVEYKIKEGVHIANQNGVKLFVNDYWQFAVKYKAYGV
HLGQEDLRSANFNEIYNAGLRLGISTHCYHELAIAKYIRPSYIAFGPIFPTTLKNMNFMP
QGTDLLNYWVKNLPYKIVAIGGINLSNVDSVIGTGVDGIAVISAVLNSEYPDKVVHEFIQ
KCQI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaggatgctttaattatagcaagagcttctgctaatcaatctgttgaagatgct
agttttttagatgaaaggtatttccctattattacgcttaataaagattattattttgat
aaaaattttcatcctatgcttgatcctgtaggtttttaccaaatagtgccagatctattt
tggttgaagtatgtaattaatttaggggttaaagtagtacagctgagaattaaaaatgaa
ccaatagaagaagtagagtataaaataaaggaaggtgtacatattgcaaatcaaaatggt
gtaaaattgtttgtgaatgattattggcagtttgcagtaaagtataaagcttatggagtg
catttaggacaggaggacttgaggagtgcaaactttaatgaaatatataatgcaggattg
agactaggtattagtacccattgttatcatgaattagcaatagcgaaatatatacgtcct
tcatatattgcttttggccctatttttcctactacattaaaaaacatgaattttatgcca
cagggtacagatttacttaattattgggttaagaatttaccttataaaattgtggctatt
ggtggcattaatttgtcaaatgtggattcagtaattggaactggtgttgacggcatagct
gttatatctgctgtgttaaatagtgaatatcctgataaagtggtacatgagtttatacaa
aaatgccaaatctag

DBGET integrated database retrieval system