KEGG   Ehrlichia chaffeensis Arkansas: ECH_0899Help
Entry
ECH_0899          CDS       T00328                                 

Gene name
lon
Definition
(GenBank) ATP-dependent protease La
  KO
K01338  ATP-dependent Lon protease [EC:3.4.21.53]
Organism
ech  Ehrlichia chaffeensis Arkansas
Brite
Enzymes [BR:ech01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     ECH_0899 (lon)
Peptidases [BR:ech01002]
 Serine Peptidases
  Family S16: lon protease family
   ECH_0899 (lon)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lon_C LON_substr_bdg AAA AAA_5 ChlI AAA_16 RuvB_N AAA_2 AAA_PrkA AAA_18 AAA_14 AAA_22 IstB_IS21 NACHT AAA_33 AAA_17 Sigma54_activat TsaE RNA_helicase AAA_24 ClpB_D2-small UBX Zeta_toxin MMR_HSR1 AAA_28 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABD44716
UniProt: Q2GFU0
Position
complement(925192..927600)
Genome map
AA seq 802 aa AA seqDB search
MKNKTLLPVLTLRDTIVFPQVVIPLFVGRERSINALEYAAQHNNCKILLLTQIDGSVDNP
TADDLYKVGIVAEVVQLLRLPDGAVKILIKGESRAKALEIIEDNLFFKAYVSVVREDTDL
VIDDKLEALKRSVLSEFDNWNKLSKKIQAEAAASIYDMKELSHLADIIASHLSIKISDKQ
IVLETFNVTKRLEKIYDFLKLEISVLNVQKKIRNRVKSQFETTQKVYYLNEQLKAIQKEL
EESDSSSVDIDSASEFEKRINSTPLSDEAKERLMTDLKRYKKMNFMSPEANIISSYLHWV
LDLPWGKYSNSKINMSNSIKILDNNHYGMDKIKERILEFLAVLKRLKKPKGPILCLVGPP
GVGKTSLARSIAEATGRNFIHMSLGGIHDESEIRGHRRTYVGAMPGKIIKEMKKAKTCNP
LFLLDEIDKIGSDFRGDPTAALLEVLDPEHNKHFVDHYIEVEFDLSNVMFIATANTLNLS
KPLIDRMEIINISGYTENEKLEIAKTHLIPKLYKDHGLQEKEWSISDNAIYHLIRMYTRE
SGVRSFKREIASLMRKAVKEILVNKEVKSICVDMDNIEKYAGVRKFSFGVIEEEDLVGMV
TGLAYTDSGGDILTIESVLMSGKGEVKYTGKLGEIMQESVKAAYSYVRSRCLNFGINPKK
FLENDIHVHVPEGAVPKDGPSAGIAMCTSIVSLMTNIPVKNTVAMTGEVTLRGRVLPIGG
LREKLLAALRSGIKTVILPSRNEKDIVEIPDNIKEGLELVFVSNVDEVISAALTRQIVDI
VKQDHIVTQDMVEIDDLDAVQH
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaaactttactaccagtactcacgctacgtgatactatagtatttcctcaa
gtagtaataccgttatttgttggaagagaaagatctattaatgctttagagtatgctgct
cagcataataattgtaaaattttattattaactcaaattgatgggtctgttgataatcct
actgctgatgatttatataaagtaggaatagtagcagaggttgttcaattgttaaggctt
cctgatggtgctgtcaaaattttaatcaaaggagaaagtagagctaaagcgctagaaatt
attgaagataatctgttttttaaagcatatgtatctgttgtacgtgaggatacagattta
gtaattgatgataaacttgaggcattaaaaagatcagtattaagtgaatttgataattgg
aataaattgagcaaaaaaatacaagcagaagctgcagcatcaatttatgatatgaaagaa
ttaagtcacttagcagatattatagcttcacatctaagtataaagatttcagataaacag
atagttcttgaaactttcaatgtgactaaaagattagagaaaatatatgacttcttaaag
ctagaaattagtgtattaaatgttcaaaagaaaatccgtaaccgtgttaaatctcagttt
gaaacgactcaaaaagtgtattatttaaatgagcagttaaaagctatacaaaaagaacta
gaggaaagtgatagttctagcgtagacatagactctgctagcgaatttgagaagagaata
aattctacaccactatctgatgaagctaaagaacgtcttatgaccgatttaaagagatat
aaaaagatgaattttatgtctcctgaagctaatataatatctagctatcttcattgggtt
cttgatttgccatggggtaaatattcaaattcaaaaattaacatgagtaattccataaaa
attttagataataatcattatggaatggataaaataaaagaaagaattttggaattttta
gctgttttaaagcgtcttaaaaagcctaaaggccctatattatgtttagttggacctcct
ggtgtgggtaaaacatcgcttgctaggtcaattgctgaggcaacgggtagaaattttata
catatgtctttagggggaatacatgatgaatcagaaataaggggacatcgtagaacttac
gtaggggcgatgccaggtaagattattaaagaaatgaagaaagcaaaaacatgtaatccc
ttattccttttagatgaaatagataaaataggttctgatttccgaggagatcctacagct
gcattgcttgaggtattagatcctgagcataataagcattttgttgatcactacatagag
gtagagtttgatctttcgaatgttatgtttattgcgacagcaaatactttaaacttaagt
aagccgttaattgaccgtatggagataatcaatatatctggatatacggagaatgagaag
ttagaaattgctaaaacgcatctaataccaaagttatataaagatcatgggttacaggaa
aaagaatggagcatttctgataatgcaatatatcatcttataaggatgtatactagagaa
agtggtgtacgaagttttaagagagagattgctagccttatgaggaaagcagtaaaggaa
atattagttaataaggaagtaaaaagtatctgtgtagatatggataatatcgaaaagtat
gcaggtgtgcgaaaattttctttcggtgtaatagaagaagaagatctagtaggtatggtt
acagggttagcctatactgattcaggaggggatatattaacaatagaatcggtgttaatg
tctggtaaaggtgaagtaaaatatactggtaagttaggtgaaataatgcaggaatctgtc
aaagctgcatatagttatgtacgttctagatgcttaaattttggaataaatcctaagaag
tttttagaaaatgatatacatgttcatgttcctgagggtgctgttcctaaagatggtcca
tcagcagggatagctatgtgtacttctattgtatcattgatgactaatattccagtaaag
aatactgttgctatgactggtgaagtaactttaaggggaagagttcttcctattggtggt
ttacgtgaaaagttattagctgcattaagaagtggtatcaaaactgttatattaccatct
agaaatgaaaaagatattgtagagattccagataatattaaggaaggattagaactagtt
tttgtatctaatgttgatgaagtaattagtgcagccttaacgcggcagattgttgatatt
gtaaagcaagatcacattgtaacgcaggatatggttgaaattgatgatttagatgcagtg
caacattag

DBGET integrated database retrieval system