KEGG   Ehrlichia chaffeensis Arkansas: ECH_0910Help
Entry
ECH_0910          CDS       T00328                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AI-2E_transport
Motif
Other DBs
NCBI-ProteinID: ABD44740
UniProt: Q2GFT1
Position
complement(935108..936247)
Genome map
AA seq 379 aa AA seqDB search
MHVHRLMSDQFCKLINRYVTRSVIVLAIVLVMFVIKPVLAPCCTAMIMAYLLNPLVDKLQ
RFKLSRQLSVAIILLSSLCVIIAFLVSFIPLAYSQLLSLIKFLMEKVPLIHKDSIISLLQ
KYNMIDYEEVSDAIKLPQASLKSLLHYENIKPLVSIFGNFLKNLDGILFSAINSSISISY
TISIILITPLLLFYILCNWPSIVESADALVPVKYQSIARLYTKKIDQVISAYIRGQLSVC
FIMAVYYIICFSLVKLKYFLIIGFVSGIMTFIPYIGPISCAILSSITTMLQFNDWTMCGV
VVTMFIVGQLVESNIITPLLIGKRVDIHPIWIIIGMITCGSQIGFTGVLLSIPITAIVGV
FVRALIAHYMGSKFYNNAD
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtgcatagactaatgagcgatcaattttgcaagctaattaataggtatgtaaca
cgtagtgttattgtactagcaattgttttggtgatgtttgttattaaacctgtacttgct
ccgtgttgtactgctatgataatggcttatcttcttaatccattggtggataagttacaa
agatttaaactatcaaggcaactatctgttgctataattttgctatcttcgttgtgtgta
attatagcatttttggtcagttttattccccttgcttattctcagttgttatcacttata
aagtttcttatggaaaaagtgccattgattcataaagacagtatcatttctctccttcag
aaatataatatgattgattatgaagaagtatcggatgcaataaagttgccgcaagcgtct
ttaaaaagtttgttgcattacgaaaacattaaacctcttgtaagtatttttggaaatttt
ctaaaaaatttagatggtatattgtttagtgcaataaattctagtataagcattagttat
acaatttctataatattaataactcctctattattattttatatattatgtaactggcca
tcgattgttgaatctgctgatgcactagttcctgtaaaatatcaaagtattgctagatta
tatacaaaaaaaatagaccaagtaatttcagcttatattagaggccaattaagtgtatgt
tttatcatggctgtatactacattatatgttttagtttggtgaagttaaagtatttttta
attataggttttgtatcgggaatcatgacttttattccatatataggacctatttcatgt
gcaatattgagttccattacaacaatgttacagtttaatgattggacgatgtgtggagtg
gtagtgacaatgttcattgttggacagttagttgagtcgaatattattactccattatta
ataggaaaacgggtagatatacatcctatatggataattattggaatgataacatgtgga
tcacaaattggatttacaggggtattattgtcaattcctataacagcaatagttggtgta
tttgtaagagcacttatagcccactatatgggtagtaaattttataataatgctgattga

DBGET integrated database retrieval system