KEGG   Ehrlichia chaffeensis Arkansas: ECH_0913Help
Entry
ECH_0913          CDS       T00328                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA G-alpha AAA_16 AAA_24 RNA_helicase DUF4729 Tweety AAA_33 IstB_IS21 AAA_22 NACHT
Motif
Other DBs
NCBI-ProteinID: ABD45052
UniProt: Q2GFS9
Position
937685..938341
Genome map
AA seq 218 aa AA seqDB search
MQLTLFDLEDSYSYHYHDYILLEQNRTTYNMLMNQEWNSFILYGKSGSGKTHLAHIWQKL
KNAIFIDQHLINTKKDIGDTISNGNAFIIENIDNIDNELSMLHHYNYIKENKKLLLMTSS
IAPTLLNYHTKDLKSRILHTMSAKLANPDEELLKIMLIKLFADKQIHIELKVINYILNNT
ERSFQNLSNIVKCIDRNLPYYNNGVTIPFVKSIIEKND
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaacattatttgatcttgaagatagttattcataccattaccacgactacata
ctgttagagcaaaacagaacaacatacaatatgctaatgaatcaagaatggaactccttc
attctatatggaaaatcaggatcaggtaaaacccatcttgcacacatatggcaaaaactt
aaaaatgccatttttattgaccaacatctaatcaacactaaaaaagatataggagacaca
atatcaaatggtaacgcctttataattgaaaatatagataacatagataatgaactatca
atgttacatcactacaactatataaaagaaaacaaaaaattattactaatgacttcttct
atagctccaacattactcaactatcatacaaaagatttaaaatcccgtatattacatact
atgagtgccaaattagctaacccagatgaagaattattaaaaattatgcttataaaacta
tttgctgataaacaaatacacatagaactaaaagttataaactatattctcaataacaca
gaacgttcttttcaaaatttgagcaatatagtaaaatgcatagacagaaacctaccttac
tataataatggcgtcactataccatttgtaaaatctataatagaaaaaaatgactaa

DBGET integrated database retrieval system