KEGG   Ehrlichia chaffeensis Arkansas: ECH_0914Help
Entry
ECH_0914          CDS       T00328                                 

Gene name
thiD
Definition
(GenBank) phosphomethylpyrimidine kinase
  KO
K00941  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00730  Thiamine metabolism
ech01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ech00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ECH_0914 (thiD)
Enzymes [BR:ech01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     ECH_0914 (thiD)
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     ECH_0914 (thiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phos_pyr_kin Carb_kinase PfkB HK
Motif
Other DBs
NCBI-ProteinID: ABD44812
UniProt: Q2GFS8
Position
938334..939143
Genome map
AA seq 269 aa AA seqDB search
MTKHQYKGRVLTIAGSDSGGGAGIQADIKTISALGCYAASCITSVTAQNTTQVYSVYNMP
QHIIQQQIEVVLSDINIDTIKIGMLPSSKAIKAVAQSLPDIPIIVDPVMVSASNFRLMDS
SAISDFIEYIIPKTTIITPNIPEAEALAQIEIKDQNDMTKASKIIKSLGTKHVLIKGGHI
NQEIINNILLTEENQIINFSHKRISKKELHGTGCTLSSAIASFIAQKMSIQESVNLAIQY
ILNTIKIVPQIGKGNNPVFHNYNTISSDL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacatcaatataaaggtcgagtattaactatagccggttctgattcaggaggt
ggtgctggtatccaagcagatatcaaaactatatcagcattgggatgttatgctgcaagt
tgtattacatcagtaacagcacagaatacaactcaagtttacagtgtatataatatgcca
caacatattatccagcaacaaatagaagttgttttatctgacattaatatagacaccatt
aaaattggtatgttaccttcctctaaagcaataaaagcagtagcacaatccttgccagat
atccctattattgtagatccagtaatggtatcggcatcaaattttagattaatggacagt
agtgcaatttctgactttatagaatatataattccaaaaacaacaataattacaccaaat
ataccagaagcagaagctttagctcaaattgagataaaagatcaaaatgacatgacaaaa
gcaagtaagataataaaatcacttgggactaaacacgttctgattaaaggaggacacatc
aatcaagagattataaataacattttactaacagaagaaaatcaaattataaatttctca
cataaaagaatatctaagaaggaattacatggcacaggttgtactctatcgtcagccatt
gcaagttttatagcacagaagatgtcaatacaagaaagtgtaaatctagcaatccaatat
atcctcaataccataaagatagtaccacaaataggaaaaggcaataatcctgtcttccat
aactacaatacaatcagtagtgacctttaa

DBGET integrated database retrieval system