KEGG   Ehrlichia chaffeensis Arkansas: ECH_0918Help
Entry
ECH_0918          CDS       T00328                                 

Gene name
sdhC
Definition
(GenBank) succinate dehydrogenase, cytochrome b556 subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00020  Citrate cycle (TCA cycle)
ech00190  Oxidative phosphorylation
ech00650  Butanoate metabolism
ech01100  Metabolic pathways
ech01110  Biosynthesis of secondary metabolites
ech01120  Microbial metabolism in diverse environments
ech01130  Biosynthesis of antibiotics
ech01200  Carbon metabolism
Module
ech_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ech_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ech_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ech00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECH_0918 (sdhC)
   00650 Butanoate metabolism
    ECH_0918 (sdhC)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECH_0918 (sdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABD45320
UniProt: Q2GFS4
Position
complement(941669..942055)
Genome map
AA seq 128 aa AA seqDB search
MSKVRPLSPHLQIYKVVYKLSIMHRFTGMILFLGLLVLSWGFILSFLCPQVVYRICSFFC
NSYVSLYSLKLITFIWLNVLCYHYMNGIRHIFWDLGLGLSKSAVRTTGVVVVFLCLVSSF
ILYSFFLS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagttaggcctttatcaccgcatttacaaatatacaaagttgtatataagctt
tctattatgcataggtttactggtatgatactatttttaggtctgctggttctatcatgg
ggttttattctttcttttttatgtcctcaagtagtatatagaatttgtagttttttttgt
aattcttatgtttcattatattctctaaagttaataacttttatttggttgaatgtattg
tgctaccattatatgaatggtataaggcatattttctgggatttaggattgggtttgagt
aaatctgcggtgagaactacgggagtggtagttgtttttttatgtctagtctcatctttt
atactttatagttttttcttaagttaa

DBGET integrated database retrieval system