KEGG   Ehrlichia chaffeensis Arkansas: ECH_0927Help
Entry
ECH_0927          CDS       T00328                                 

Definition
(GenBank) hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_lgN
Motif
Other DBs
NCBI-ProteinID: ABD45335
UniProt: Q2GFR6
Position
complement(950905..951009)
Genome map
AA seq 34 aa AA seqDB search
MLDNTEYIDKLYENLHHQIFTPSTNVAHGLILLE
NT seq 105 nt NT seq  +upstreamnt  +downstreamnt
atgttagataatacagaatatattgataagctttatgagaatttgcaccatcaaatattt
actcctagcacaaatgttgcacatgggttaatacttctagagtaa

DBGET integrated database retrieval system