KEGG   Ehrlichia chaffeensis Arkansas: ECH_0933Help
Entry
ECH_0933          CDS       T00328                                 

Definition
(GenBank) hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABD45191
UniProt: Q2GFR0
Position
complement(954451..954558)
Genome map
AA seq 35 aa AA seqDB search
MMKEFNVYRLYVEESMMICCVLLTVLHCVIMICFL
NT seq 108 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagaattcaacgtttataggttatatgttgaagagtcaatgatgatatgttgt
gtacttttgactgtgttacattgtgtcattatgatatgctttttataa

DBGET integrated database retrieval system