KEGG   Ehrlichia chaffeensis Arkansas: ECH_0943Help
Entry
ECH_0943          CDS       T00328                                 

Definition
(GenBank) hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgtE_N
Motif
Other DBs
NCBI-ProteinID: ABD45475
UniProt: Q2GFQ1
Position
complement(962402..963079)
Genome map
AA seq 225 aa AA seqDB search
MFYYNILDSKALYNSFINSMQVIYIVNVILIFCITGVVLHNFYGIDNDKIVEFGLLNDVE
FVKSDDCFFRDSNQKIKLFPVNSELISVVDLQDWYYRLLEQENSLKDKEALLKIAGQHNN
DQMLYLEEMKKNLVSLINISTQNYDEKVHGLVKIYESIPVELAAEVFELLDIDSLMLIAN
NIDKDILSDILLHASTNVVEKIKEISANISKQQCNYNNGVVKNNV
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgttttattataacatacttgattctaaggcattgtataatagttttattaatagtatg
caagtgatttatattgttaatgtgatattaatattctgtataactggggttgtattacat
aatttttatggcattgataatgataaaattgtggaatttggtttgttgaatgatgtggaa
tttgtaaaaagtgatgattgtttttttagagattcaaatcaaaaaataaaattgtttcca
gtaaatagtgagcttatatctgttgtagatttgcaggattggtattatcgcttgttggag
caagaaaatagtttaaaagataaagaggctttgctaaaaattgctgggcagcataataat
gatcaaatgttatatttagaagagatgaaaaaaaatttagtatcattgattaatattagt
actcaaaattatgatgaaaaagtgcatggtttagtaaaaatatatgaaagtatacctgta
gaattggctgctgaagtctttgaattgttggatatagattcattaatgttaatagctaat
aatattgataaggatattttgtcggatatattgttacatgcaagtacaaatgtagttgaa
aagattaaagagatatctgcaaatatatctaagcagcaatgtaattataataatggtgtt
gttaaaaataacgtttag

DBGET integrated database retrieval system