KEGG   Ehrlichia chaffeensis Arkansas: ECH_0944Help
Entry
ECH_0944          CDS       T00328                                 

Definition
(GenBank) Na+/H+ ion antiporter family protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MNHE Ntox10
Motif
Other DBs
NCBI-ProteinID: ABD45081
UniProt: Q2GFQ0
Position
963170..963661
Genome map
AA seq 163 aa AA seqDB search
MKAFFTLFIFWFALSGYLDLFFITSGITSCIITLVIARMLQNVIPANKNYTYYISKKQFL
PFTFHFLRYFFWIMQQVVLSNIHIIKKIWNLSITINPPIFRVIETKQITGLNISTVANSI
TLTPGTVSINVTEYSSPYKITVLAIDEESMSGVIDIDNKIASI
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgtttttcacattgttcatattttggtttgccctatcagggtatcttgatcta
ttttttataacatcaggtattacaagctgtattattacactagtcatagcaagaatgcta
cagaatgttataccagcaaataagaattacacttactacatatcaaaaaaacaattcctt
cctttcacatttcactttttacgttattttttttggatcatgcaacaggttgtactgtct
aatatacacataataaaaaaaatatggaatttgagtataacaatcaatccaccaattttt
agagtaatagaaaccaagcaaattaccggcttaaatatatcaacagttgcaaattctatt
acacttactcctggcacagtaagtataaatgttacagaatattctagcccatacaaaata
acagttttagctatagatgaagagtcaatgtctggtgtaatagatattgataataaaatt
gcaagtatataa

DBGET integrated database retrieval system