KEGG   Ehrlichia chaffeensis Arkansas: ECH_0946Help
Entry
ECH_0946          CDS       T00328                                 

Gene name
rnhB
Definition
(GenBank) ribonuclease HII
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech03030  DNA replication
Brite
KEGG Orthology (KO) [BR:ech00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ECH_0946 (rnhB)
Enzymes [BR:ech01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     ECH_0946 (rnhB)
DNA replication proteins [BR:ech03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     ECH_0946 (rnhB)
   Elongation factors (archaeal)
     ECH_0946 (rnhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_HII
Motif
Other DBs
NCBI-ProteinID: ABD45547
UniProt: Q2GFP8
Position
968499..969128
Genome map
AA seq 209 aa AA seqDB search
MPDFSIENEISKLINNKHCTIVGVDEVGYGSLAGPVVSAAVFFPKHDNHITYNIQDSKKL
TPKKRLEIYNIITPMVKWSIGLAEVHEIDQYNILNATHIAMQRALRGLNSNIDYVIVDGN
KVPELPWNAKAVVDGDNISISIAAASIIAKVTRDKLMETLHIQFPQYNWNKNKGYGTKHH
LESLHKYGKTIHHRNTFAPASGITKLYNK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgccagatttttctatagaaaatgaaatatcaaaattaataaataataaacactgtact
atagtaggagttgacgaagtaggatatggttcattagctggccctgtagtatcagctgct
gttttttttccaaaacatgacaatcacatcacatacaatattcaagattcaaaaaaactc
actccaaaaaaaaggctagaaatttataatataatcactcctatggtaaaatggagtata
gggcttgctgaagtgcatgaaattgaccagtataatatactaaatgctacacatattgct
atgcaaagggcacttagagggttaaattctaatatagattatgtaatagtagatggaaat
aaagttccagagctaccatggaatgcaaaagccgttgtagatggagataacataagtata
tcaattgcagcagcatctataattgcaaaagtcacacgagataaactaatggaaacacta
cacatacaattcccacaatacaactggaacaaaaataaagggtatggtactaaacatcat
ttagagtctttacataagtatggtaaaactatacaccacagaaatacatttgccccagca
tcagggataactaaactttacaataaatga

DBGET integrated database retrieval system