KEGG   Ehrlichia chaffeensis Arkansas: ECH_0950Help
Entry
ECH_0950          CDS       T00328                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00780  Biotin metabolism
ech01100  Metabolic pathways
Module
ech_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ECH_0950 (bioF)
Enzymes [BR:ech01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     ECH_0950 (bioF)
Amino acid related enzymes [BR:ech01007]
 Aminotransferase (transaminase)
  Class II
   ECH_0950 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 SHMT Beta_elim_lyase Glyoxalase
Motif
Other DBs
NCBI-ProteinID: ABD45323
UniProt: Q2GFP5
Position
complement(970501..971604)
Genome map
AA seq 367 aa AA seqDB search
MLDEILNQELIKLKVDNLYREPSTVTRSEVGCLVCQNNERLVSFSCNDYLGLIGHPLLKE
SAINAINNYGVGAGASRMVTGNNILYQCLEDKLAKLYHTEMALVFSSGYLTNVGVISALV
HRHDMIISDKLVHSSIIDGIKLSSAKHYRFEHNDYGHCEDILKKYRRLHKYCFIVVEQVY
SMNGDIAPIDQLKKLAEKYSAWLIVDCAHGFGLIPCANSDIYIGTLSKAVGVLGGYVCAS
EVVIKYIQNKAKTFIYTTALPPMVIAAANAALDIISASVNDIPIKLAKFFCKNLNLAEPS
SHIVPLIMKNMNSVLHAQQVLREAGFLVVAIRPPTVPTPRLRFVFSVNHSLSDIEKLCEV
IKRNKLA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgaaatattaaatcaagaacttattaaattaaaggttgataatttatataga
gaaccttctactgtaactagatctgaagtaggttgtttggtttgtcaaaataacgagaga
ttagtttccttctcttgtaatgattatttagggttaataggtcatcctttattaaaagag
tcagctataaatgcgataaataattatggtgtaggtgctggtgcctcacgcatggttaca
gggaataatatcctttatcaatgcttagaagataaattagcaaagttatatcatacagaa
atggctttagtatttagtagtggttatttaacaaatgtaggtgttatttctgctttagtg
catagacatgatatgatcatttctgacaaattagtacattcttctattatagatggtatt
aaactttcttctgctaagcattataggtttgagcataatgattatggacattgtgaagat
atattaaaaaaatataggaggttacataagtactgttttattgtagttgagcaagtgtat
agtatgaatggtgatattgctccaattgatcagttaaaaaaattggcggaaaaatatagt
gcgtggcttattgtggattgtgctcatggatttggattaataccttgtgctaattcagat
atatacattggtactttatctaaagcagttggtgttttaggtggatatgtatgtgcatcg
gaggttgttataaagtatatacagaataaagctaaaacttttatatatacgactgctcta
cctccgatggttattgctgctgcgaatgctgcgttggatattataagtgcatctgttaat
gatatacctattaaattggctaaatttttttgtaaaaatctgaatcttgctgaacctagt
agtcatatagtaccattaattatgaaaaatatgaatagcgttttacatgcacagcaagtg
ttaagggaagcaggttttcttgttgtggcaatacgtcctcctactgtaccgactccaaga
ctgagatttgtatttagtgtgaatcatagcttatcagatatagagaaattgtgtgaagtt
ataaaacgaaataagttagcctaa

DBGET integrated database retrieval system