KEGG   Ehrlichia chaffeensis Arkansas: ECH_0953Help
Entry
ECH_0953          CDS       T00328                                 

Gene name
rplL
Definition
(GenBank) ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech03010  Ribosome
Module
ech_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ech00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    ECH_0953 (rplL)
Ribosome [BR:ech03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    ECH_0953 (rplL)
  Bacteria
    ECH_0953 (rplL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N YecR
Motif
Other DBs
NCBI-ProteinID: ABD45006
UniProt: Q2GFP2
Position
complement(980307..980708)
Genome map
AA seq 133 aa AA seqDB search
MSTVDIDSLVEQICSLDLCKAAELVEKMEQKLGFPKGGLLTAVPAAGGNQVEGGAAAEEK
TDFSVVFESYAADKKISVIKAVRECTSLGLKEAKEFVEKEGAKELIEGKKYKKEEAEEIK
KKLEDAGAKVSIK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgttgatatagatagtttggtggagcaaatttgtagcttagatttatgtaaa
gcagcagaattagtggaaaagatggagcaaaagttagggtttcctaagggtggtttgtta
acagctgttccggctgcaggcggtaatcaagttgaaggtggtgcagcagcagaagaaaaa
acagatttctctgtagtttttgaaagctatgctgcagataagaagatttctgtgattaag
gcagtaagagagtgtactagtttaggattaaaagaagcaaaagaatttgttgaaaaagaa
ggtgcaaaagaattgatagaaggtaaaaagtataagaaagaagaagctgaagaaatcaag
aaaaagctagaagatgctggagcaaaagttagtatcaaatag

DBGET integrated database retrieval system