KEGG   Ehrlichia chaffeensis Arkansas: ECH_0958Help
Entry
ECH_0958          CDS       T00328                                 

Definition
(GenBank) putative preprotein translocase, SecE subunit
  KO
K03073  preprotein translocase subunit SecE
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech02024  Quorum sensing
ech03060  Protein export
ech03070  Bacterial secretion system
Module
ech_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:ech00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ECH_0958
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECH_0958
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECH_0958
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ech02044]
    ECH_0958
Secretion system [BR:ech02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   ECH_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecE NapE
Motif
Other DBs
NCBI-ProteinID: ABD44521
UniProt: Q2GFN7
Position
complement(982932..983129)
Genome map
AA seq 65 aa AA seqDB search
MNNIAKFLLGVKQEALQVSWASKNEVIGFLFIVILIITFMSVLFCCVDFLFLKLIKIVLG
VIYEI
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgaataatattgctaagtttttacttggggtaaaacaggaagctttacaagtttcttgg
gcttctaaaaatgaggttatagggtttttatttatagtaatattaataattacttttatg
tctgttttgttttgttgtgtggattttttatttttgaagttgataaagatagtacttggg
gtaatttatgaaatatga

DBGET integrated database retrieval system