KEGG   Ehrlichia chaffeensis Arkansas: ECH_0961Help
Entry
ECH_0961          CDS       T00328                                 

Gene name
fusA
Definition
(GenBank) translation elongation factor G
  KO
K02355  elongation factor G
Organism
ech  Ehrlichia chaffeensis Arkansas
Brite
Translation factors [BR:ech03012]
 Eukaryotic Type
  Elongation factors
   ECH_0961 (fusA)
 Prokaryotic Type
   ECH_0961 (fusA)
Mitochondrial biogenesis [BR:ech03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ECH_0961 (fusA)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    ECH_0961 (fusA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU EFG_IV EFG_II EFG_C GTP_EFTU_D2 RF3_C MMR_HSR1 AIG1
Motif
Other DBs
NCBI-ProteinID: ABD45028
UniProt: Q2GFN5
Position
complement(984464..986536)
Genome map
AA seq 690 aa AA seqDB search
MSIDNELSKCRNIGIMAHIDAGKTTTTERILFYTGKQNRIGEVHEGAASMDWMEQEKERG
ITITSAATTCFWNGHRINIIDTPGHVDFTIEVERSLRVLDGAVAVFDGVAGVEPQSETVW
RQADKYNVPRICFMNKMDRMGADFYRCVDMVVERLGATPLVLQLPIGIEKDFVGVVDLLE
MRSIIWDEDSLGASFHYGEIPKDMLDKAQEYRNKLLESAVELNDEAMNLYFEGKEISVSL
LKSCIRAGVIQSKFVPVLCGSAFKNRGVQPLLDAVVDFLPAPNDIPMMEALDVKTSNTIN
IKSSIDGKFVALAFKVMTDKFVGSLTFIRIYSGRLSSKTTVLNAVKNSTESIGRILLMHA
NNREDITEAKAGDIVALAGLKKTVTGDTLCTLDQPIILERMEFPEPVMEIAVEPKSTADQ
EKMGIALSRLVAEDPSLGMCVNPESGQTILKGMGELHLEVIVDRMRREFNVEANIGAPQV
AYRETITKSVEIEYIHKKQTGGAGQFAKVNILFEPLPPGSGFQFESKITGGAIPKEYIPG
VQNGLENIRGSGMLAGFPVIDFKATLVDGAFHEVDSSPLAFELAAKGAFRDMVNKAGAIL
LEPIMKVEIITPDEYMGDVIGDINSRRGRVAEMQDRHNTKVILAFIPLAKMFGYVKDLRS
MSQGRAQYSMYFSCYEQVPDNIVANEIKTK
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatagataacgagttatctaagtgtaggaatatagggattatggcgcatatagat
gccgggaagactactacaactgagcgtatacttttttatactggaaaacaaaatagaatt
ggtgaggttcatgaaggtgctgcatctatggattggatggagcaagaaaaggagagagga
attacaataacttctgcagctactacatgtttttggaatggtcataggattaacattatt
gatactcctggtcatgttgattttactatagaggtagaaaggtctttacgtgttttagat
ggtgctgttgctgtctttgatggagttgcgggtgttgaacctcaatcagaaacagtgtgg
cgtcaagctgataaatataatgtacccagaatttgttttatgaataaaatggataggatg
ggagcagacttttatcggtgtgttgatatggttgttgaacgtctgggtgctactccatta
gtattgcaattaccaataggaattgagaaagattttgttggtgttgttgatttattggag
atgagatcaattatatgggatgaagattctctaggagcaagttttcattatggagaaatc
cctaaagatatgcttgataaagctcaagaatatagaaataagcttctggaaagtgcagtt
gagcttaatgatgaagcaatgaatttgtattttgaaggtaaggaaatatctgtttcttta
ttgaaaagttgtattcgtgcaggagtaattcagtcaaaatttgtacctgttttgtgtggt
tctgcgtttaaaaacaggggagtacagccattactagatgctgttgttgattttttgcct
gcgcctaatgatattcctatgatggaagctctcgatgtaaagacttctaatactataaac
attaagtcttctattgatggtaaatttgttgcgttagcttttaaagtaatgactgataaa
tttgttggtagtttgacttttataagaatttactcaggaaggttatcaagtaagactaca
gtactgaatgcagttaaaaattctacagaatctataggtagaattttattaatgcatgct
aacaatagagaggatatcactgaagcaaaagctggtgatattgttgctttagctgggctt
aaaaagacggtaactggtgatacattatgtactttagaccaacctataattttagagcgc
atggaatttcctgaaccagttatggagattgcagtagaaccaaaatctacagcggatcaa
gaaaaaatgggtatagctttaagtagattagttgcagaagatccatcacttggtatgtgt
gtaaatcctgaaagtggacaaactatcttgaaaggaatgggtgaattgcatcttgaagtt
attgtagatagaatgcgtcgtgagtttaatgttgaagctaatataggtgctccgcaagtt
gcttacagagaaactattactaaatctgttgaaattgaatatattcataaaaagcaaaca
ggtggtgctgggcagtttgcaaaggtgaatatattatttgaaccattacctcctggttct
ggtttccaatttgaaagtaaaattactggtggtgcaatacctaaagaatatataccaggt
gttcaaaatgggttagaaaatattagaggaagtggtatgttagcagggtttcctgttatt
gattttaaagcaacattagttgatggtgcatttcatgaagtagattctagtccattagca
tttgagttagctgcaaaaggtgcttttagagatatggtgaacaaagctggtgcaatatta
cttgaacctattatgaaagttgagataataactcctgatgagtacatgggggatgttata
ggtgatattaatagtaggagaggtagggttgctgaaatgcaagatcgtcacaatactaaa
gtaatattagcatttattcctttggcaaaaatgtttggttatgttaaagatttgcgctct
atgtctcagggtagagcacaatatagcatgtatttttcttgttatgaacaagtacctgat
aatatagtggcaaacgagataaaaactaaataa

DBGET integrated database retrieval system