KEGG   Ehrlichia chaffeensis Arkansas: ECH_0963Help
Entry
ECH_0963          CDS       T00328                                 

Gene name
rpsL
Definition
(GenBank) ribosomal protein S12
  KO
K02950  small subunit ribosomal protein S12
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech03010  Ribosome
Module
ech_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ech00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ECH_0963 (rpsL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ech03011]
    ECH_0963 (rpsL)
Ribosome [BR:ech03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    ECH_0963 (rpsL)
  Bacteria
    ECH_0963 (rpsL)
  Archaea
    ECH_0963 (rpsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosom_S12_S23
Motif
Other DBs
NCBI-ProteinID: ABD44798
UniProt: Q2GFN3
Position
complement(987058..987429)
Genome map
AA seq 123 aa AA seqDB search
MPTINQLVRKPRKSRSSLNKAPALQHNPQKRAVCVKVYTTTPKKPNSALRKVARVKIAGY
GSEVIAYIPGEGHNLQEHSVILIRGGRVKDLPGVRYHIIRGALDSRGVQNRKKARSKYGV
KKS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaataaatcaattagtccgcaaaccgcgaaaatctcgttcttcattaaataag
gcgcctgcacttcaacataatccgcaaaaaagagcagtgtgtgtaaaagtatatactact
actcctaagaagccaaactcagctttgcgtaaagttgcgcgtgtaaaaattgctggttat
ggtagtgaggttatagcttatatacctggtgaggggcataatttacaggagcattcagtt
atcttaattagaggtgggcgtgtaaaagatttacctggggttcgatatcatattatacgt
ggagcattggattctagaggagtgcaaaataggaagaaggcgcgctcaaagtatggtgtg
aagaaaagttaa

DBGET integrated database retrieval system