KEGG   Ehrlichia chaffeensis Arkansas: ECH_0966Help
Entry
ECH_0966          CDS       T00328                                 

Definition
(GenBank) metallo-beta-lactamase family, beta-CASP subfamily
  KO
K12574  ribonuclease J [EC:3.1.-.-]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ech00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ECH_0966
Enzymes [BR:ech01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     ECH_0966
Messenger RNA biogenesis [BR:ech03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     ECH_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2 RMMBL Lactamase_B_6
Motif
Other DBs
NCBI-ProteinID: ABD45297
UniProt: Q2GFN0
Position
989839..991461
Genome map
AA seq 540 aa AA seqDB search
MNTDDLLFTPLGGVGQIGMNVNLYHLNGKWIIIDFGAGFADDNMPGIDMIVADISFIKKN
RKNLLGIVLTHAHEDHIGGIQYLWNDLQCPIYATKFTAALLQAKLKEYPFRINITEIDIT
KKLNLGPFTLEFINLTHSIPEMNAIALHTEKGIVVHTGDWKLDDNPIIGPVSNTQRLKEL
GDEGVLALVCDSTNIFTKNKSGSESDLEKSIFNIIKNCNQKVAVSLFASNIARIYTIVNI
ATKLGRKVAILGKSLIRIIQAAQDSGYLQDIPEFININQANKLPNDQVLLLCTGCQGEEL
AATAKLANNSHPFTKLDNGDTIIFSSKIIPGNEKRIYSVFNKFVNMGVNVITEFMEHVHV
SGHPSKSEVSTMYSLVRPKLSIPVHGEYIHMHEHAKVAKQCNVEKAIIVHPGDVISLTKK
QKINSVKAGYFGVDGNFLHHPKGNVISMRKKMRDAGIIIITLVLNNKKELLKEPRIFAPG
VLDHSNSQAILKKVSSKISSELYSRKINNIRQYVENTVFNALKYDIKNKPFIEVQLEYIN
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgatgatttattgttcacacccttaggcggagtcggacaaataggcatgaat
gtcaatttatatcacttaaatggtaaatggataattattgatttcggagcaggatttgct
gatgacaatatgccaggaatagacatgattgttgctgatattagttttatcaaaaaaaat
agaaaaaacttgcttggtatagtattaacacatgctcatgaagatcacataggaggcata
caatatctgtggaacgatttgcaatgcccaatatatgcaacaaaattcacagctgcctta
ttacaagcaaaattgaaagaatatccatttagaatcaatattacagaaatcgacatcaca
aaaaaattaaatcttggcccttttactcttgagtttataaatttgacacactccatacca
gaaatgaatgcaattgcattacacactgaaaaaggaatagtagtacatacaggagattgg
aagttagatgacaacccaattattggtcctgtatcaaatacacaaagattaaaagaatta
ggagacgaaggggttttagcacttgtatgtgattcaacaaatatatttactaaaaataaa
tcaggatctgagagtgatttagaaaaaagtatatttaatataataaaaaactgtaatcaa
aaagttgcagtatctttatttgcatctaatattgcacgaatctataccatagtaaacatt
gcaacaaaattaggtagaaaagtagcaatactgggaaaatctcttataagaattatacaa
gctgcacaagacagtgggtatttgcaagatataccagagttcatcaatatcaatcaagca
aataaactcccaaatgatcaagtcttgcttctttgtactggttgccaaggtgaagagcta
gcagcaactgccaaacttgctaataattctcatccattcactaaattagataatggagat
actattatcttctcttccaagatcattccaggaaatgagaaacggatatatagtgtattc
aacaaattcgttaacatgggagttaatgttattacagaatttatggaacatgtacacgta
tcagggcacccttcaaaaagtgaagtatctactatgtattcattagtaaggcctaaatta
tccatccctgtacatggagaatacatacatatgcacgaacatgcaaaagttgcaaaacaa
tgcaacgtagaaaaagcgataatagttcacccaggagatgtaataagcctcacaaaaaaa
caaaaaattaactctgtcaaagctggatactttggagttgatggcaatttcttacaccat
cccaaaggcaatgtcatatctatgcgaaaaaagatgagagacgcagggataattataata
acactagttttaaacaacaaaaaagaattattaaaagaaccaaggatttttgctccagga
gtgctagatcattctaatagtcaagcaattctcaaaaaagtctcatctaaaataagtagc
gagctttattctagaaaaataaacaacatacgacaatacgtagaaaatacagttttcaat
gctttaaaatatgacatcaaaaacaaaccatttattgaagtacagctagaatacataaat
tag

DBGET integrated database retrieval system