KEGG   Ehrlichia chaffeensis Arkansas: ECH_0979Help
Entry
ECH_0979          CDS       T00328                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00020  Citrate cycle (TCA cycle)
ech00640  Propanoate metabolism
ech01100  Metabolic pathways
ech01110  Biosynthesis of secondary metabolites
ech01120  Microbial metabolism in diverse environments
ech01130  Biosynthesis of antibiotics
ech01200  Carbon metabolism
Module
ech_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ech_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECH_0979 (sucC)
   00640 Propanoate metabolism
    ECH_0979 (sucC)
   00660 C5-Branched dibasic acid metabolism
    ECH_0979 (sucC)
Enzymes [BR:ech01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ECH_0979 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp CHRD
Motif
Other DBs
NCBI-ProteinID: ABD45205
UniProt: Q2GFL7
Position
1001342..1002505
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQAKHILSKFGVNVPKGVVVHSLGEVDGALSQLNSKVVVVKAQIHAGGRGKAGGV
VVSRTLDETKTSIKNMLGSTLITHQTSKDGQKVRKVYLEEGCNIKKEYYISAIVNRKQGQ
VSIIFSTEGGVDIEEVAATSPEKVIVCNINPVFGFQGFHGRNLCFDSNLSLDQTRKISDI
AGKIYKAVLSTDANQIEINPLVETSSGEFIALDAKINFDDNALYRHPDIQELRDYDEEIK
EEIEASKHGLSYIKMDGNIGCMVNGAGLAMATMDIIKYYGAEPANFLDVGGGASQKTVTE
AFKIILADDKVNGILVNIFGGIMRCDIIANGIIAAIQEIGINVPLVVRLSGTNFELGKKL
LDDSNLNIITANDLSEAAYNIVNIVRK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtatcaggcaaagcatatactgagcaagtttggtgtaaacgttccg
aaaggggttgtagtacattcattaggcgaagttgatggtgctctcagtcagttaaattca
aaggtagtcgttgtaaaagctcaaatccatgctggtggtagaggaaaagctggaggagtt
gtagtatctcgtacattagatgaaaccaaaacgtctataaagaatatgttaggatcaact
ctgattactcatcagacctcaaaagatggacagaaagtaagaaaagtatatttagaagaa
ggatgcaacatcaagaaagaatattatataagtgccattgtaaatcgtaaacaaggtcag
gtaagtataatattttcaactgaaggtggtgttgacatagaagaagtagctgcaacttct
ccagaaaaagttattgtatgcaacatcaacccagtatttggattccaaggttttcatgga
cgcaatttatgctttgacagtaatttaagtttagatcaaacaagaaaaatttctgatata
gctgggaaaatatataaagctgtgttaagcactgatgctaaccagatagaaattaatcct
ctagtagaaacatcatcaggggaattcattgctcttgatgcaaaaataaacttcgatgac
aatgcactatatcgtcatcctgatattcaagaattacgtgactatgatgaagagatcaaa
gaagaaatagaagcttcaaaacatggtttaagctatataaagatggatggtaatattgga
tgtatggtaaatggtgcaggccttgctatggcaactatggacattataaaatattacggt
gctgaacctgcaaatttcttagatgtaggtggaggagcaagtcaaaaaactgttactgaa
gcattcaagattattcttgcagatgataaggttaatgggatactagttaacatatttggt
ggtataatgcgttgtgatataattgccaacggtattattgctgccatacaagaaattggt
ataaatgttccactagttgtaaggttatctggaacaaattttgaattaggaaaaaagtta
ctagatgattcaaatctaaatattattacagcaaacgatttaagtgaagcagcatacaat
atagttaatatagtaagaaaatag

DBGET integrated database retrieval system