KEGG   Ehrlichia chaffeensis Arkansas: ECH_1033Help
Entry
ECH_1033          CDS       T00328                                 

Gene name
apaG
Definition
(GenBank) apaG protein
  KO
K06195  ApaG protein
Organism
ech  Ehrlichia chaffeensis Arkansas
Brite
KEGG Orthology (KO) [BR:ech00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ECH_1033 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ABD44697
UniProt: Q2GFG4
Position
complement(1053908..1054312)
Genome map
AA seq 134 aa AA seqDB search
MTLQYYSMTKLIEVKVVPSYLEEQSAPHENCYIWLYNIRVKNKSNSTVQLLRRSWKIIDS
TGVINEVTGLGVIGKQPVLKPGEFFEYTSGAYLSTPSGMMHGEYQFMDEDAAQVFYVSIP
MFSLDSPYVNTKPH
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgacactacaatattatagtatgaccaaacttattgaagttaaagttgttccaagttac
ttagaagagcaatctgctccacatgaaaattgttatatatggttgtataacatcagagtt
aagaataaaagtaattctacagtccagctcttgaggagaagttggaaaatcattgattca
acaggtgttattaatgaagtaacaggtttaggagtaataggtaaacagcctgtattaaaa
cctggagagttttttgagtatactagtggtgcatatttaagtactccatctggtatgatg
catggggaatatcaatttatggatgaagatgctgcacaggttttttatgttagtataccg
atgttctcgctagatagtccttatgttaatacaaagccacattaa

DBGET integrated database retrieval system