KEGG   Ehrlichia chaffeensis Heartland: ECHHL_0069Help
Entry
ECHHL_0069        CDS       T03085                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
echa  Ehrlichia chaffeensis Heartland
Pathway
echa00020  Citrate cycle (TCA cycle)
echa00480  Glutathione metabolism
echa01100  Metabolic pathways
echa01110  Biosynthesis of secondary metabolites
echa01120  Microbial metabolism in diverse environments
echa01130  Biosynthesis of antibiotics
echa01200  Carbon metabolism
echa01210  2-Oxocarboxylic acid metabolism
echa01230  Biosynthesis of amino acids
Module
echa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:echa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECHHL_0069 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ECHHL_0069 (icd)
Enzymes [BR:echa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ECHHL_0069 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh TT1725 DUF1947
Motif
Other DBs
NCBI-ProteinID: AHX03246
Position
63973..65421
Genome map
AA seq 482 aa AA seqDB search
MSIPITVAYGDGIGPEIMEAVLLILSEAESGLVVETIEVGHNLYKKEWSSGIAPSSWDSI
YRTKVLLKSPTMTPQGRGHKSLNVTLRKRLGLYANIRPCISYHPVIKTRYPNLNVVIVRE
NEEDTYTGIEHRLTNDTYQCSKVITRSGSERICDYAFHYAKVHNRKRVTCLIKDNIMKMT
DGIFHKSFSKIAENYPDIESDHYIVDIGMAKVASNPENFDVIVTTNLYGDIVSDIVAELS
GSIGLAGSANIGNNYAMFEAVHGSAPDIAGKNIANPSGLLNAAIQMLMYLKQFDKAQLIY
NAFLKTLEDGIHTADIYQSQVSKKKVSTMDFAKAVVENFGQSPSQLPKSMFQDNVDRTGV
SYTYEPSYVTRVLVGVDITIGCDGVGLDFKQLINNLQNITHDKLELVLIHNKGLEIWPDE
SVSVNLSYMDQVCCRFYMKSKDDKIMNEHINQLLFDIEQKKIDVVKMEKLYLYNDQPGFF
TM
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattccaataacagttgcttatggagatggtattggcccagaaattatggaagct
gtactattgatcttgagtgaagcagaatcaggtctagttgtagaaactatagaggtggga
cacaatttatataaaaaagaatggtcttctggtattgcgccttcatcttgggattctatt
tatagaacgaaagtactgcttaagtctcctaccatgactccacaaggtcgtgggcataaa
agtcttaatgttacgttgagaaagagattagggttgtatgcaaatattaggccatgtatt
tcttatcatcctgtgataaagacaaggtatcctaatctcaatgtagtgatagttcgagaa
aatgaggaagatacatatactggtatagaacataggctgactaatgatacgtatcaatgc
tcaaaagttattacgagatcaggttcagaaagaatatgtgattatgcatttcactatgct
aaggttcataataggaagagagttacttgcttgataaaagataatattatgaaaatgaca
gatggaatttttcataagtctttttcaaagattgcagagaattatcctgacattgaatca
gatcattatattgttgatattggaatggcaaaagtggcttctaaccctgaaaattttgat
gttatagttactactaatctttatggtgatatagtgtctgatatagttgctgaattatca
gggtctataggccttgcaggtagtgctaatatagggaataattatgcaatgtttgaagct
gttcatggttcagctccagatatagctggaaagaacatagcaaatccttctggattactt
aatgcagctatacaaatgttgatgtatttaaaacagtttgacaaggcacagctaatttat
aatgcatttcttaaaactttagaagatggtattcatacagcagatatttaccaaagtcag
gttagcaagaaaaaagtttctacaatggattttgctaaggctgttgttgaaaattttgga
caatctccatctcaattaccaaaatcaatgtttcaggataatgtagataggacgggtgta
tcttatacatatgaaccatcttatgttactagagttcttgtaggagtggatattactatt
ggttgtgatggtgtaggactagattttaagcagttaattaataatcttcaaaatattaca
catgataaactggagcttgtgctaattcataataaaggattagaaatttggcctgatgaa
tctgtgagtgtaaatctttcttatatggatcaggtatgttgtaggttttacatgaaaagt
aaagatgataaaatcatgaatgagcatattaatcagttgctttttgacatagagcaaaag
aaaatagatgtagtaaaaatggaaaaattatacttatataatgatcaacctggctttttt
actatgtaa

DBGET integrated database retrieval system