KEGG   Ehrlichia chaffeensis Heartland: ECHHL_0391Help
Entry
ECHHL_0391        CDS       T03085                                 

Definition
(GenBank) polyprenyl synthetase family protein
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
echa  Ehrlichia chaffeensis Heartland
Pathway
echa00900  Terpenoid backbone biosynthesis
echa01100  Metabolic pathways
echa01110  Biosynthesis of secondary metabolites
echa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:echa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECHHL_0391
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:echa01006]
    ECHHL_0391
Enzymes [BR:echa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     ECHHL_0391
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     ECHHL_0391
Prenyltransferases [BR:echa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   ECHHL_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt Antimicrobial_6
Motif
Other DBs
NCBI-ProteinID: AHX03554
Position
complement(424748..425551)
Genome map
AA seq 267 aa AA seqDB search
MKHHSSLLVKQLESILPENNQDILLTSMRYSMFAPGKHIRPFLVNASAQIFNVNVDRILP
VSAAVEIIHVYSLIHDDLPGIDNENIRRGQASSHKKFNEAIAILTGDALLTLAFEILSTI
DESPFIRCCMIKALAKALGYQGMIQGQILDTETIAKDTNDIQAIHVLKTAQFFSVACELG
GILGNASNIELNALANYGLNLGHAFQVKDDIADANQDKSKNNILNILNNEDAQNYLNSLI
DKSIEHLTILSHKADILHSLAEFIRNL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcatagtagcttactcgtcaaacaactagaaagtattctaccagaaaataat
caagatatattattaacatccatgaggtattctatgtttgcacctggcaagcatatacgt
ccttttctcgttaatgcttctgcccaaatattcaacgttaatgtagatagaattctacct
gtcagtgcagctgtagaaattatacatgtttattcattaatacatgatgatttaccaggt
atagataacgaaaacatacgtcgaggacaagcaagttcccacaaaaaatttaacgaagca
attgcaatattaactggtgacgcactattaactctagcatttgaaatattatcaacaatt
gatgaatcaccatttatacgttgctgtatgataaaagcattagctaaagctttaggttat
caaggcatgatacaaggacaaatacttgatacagaaactatagcaaaagacacaaatgat
atacaagccatccacgtgttgaaaacagcccaatttttctctgtagcatgtgaattagga
ggaatattagggaatgcatcaaatattgaattaaatgctctagctaactacggattaaac
cttggacatgcttttcaagtaaaagatgacattgctgacgcaaatcaggataaatcaaaa
aacaacatcctcaatatattaaataacgaagatgctcaaaactatcttaatagcttgata
gacaaatctatcgaacatttaactattctttcacataaagcagatatcctacacagttta
gctgagtttataagaaatttataa

DBGET integrated database retrieval system