KEGG   Echinicola sp. LN3S3: FKX85_16850Help
Entry
FKX85_16850       CDS       T06084                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
echi  Echinicola sp. LN3S3
Pathway
echi00310  Lysine degradation
echi01100  Metabolic pathways
echi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:echi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    FKX85_16850 (lhgO)
Enzymes [BR:echi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     FKX85_16850 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_3 Lycopene_cycl Thi4 NAD_binding_8 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: QDH80618
UniProt: A0A514CLE3
Position
4313038..4314240
Genome map
AA seq 400 aa AA seqDB search
MTYDIAIVGGGIVGLATGLKIILQRPELNVVVLEKESELAKHQTGNNSGVIHSGLYYKPG
SLKATNCINGYHELVKFCEEENIPFEITGKVVVATNDEQLPLLQSLLKRGLQNGLKGTRQ
ITLDELKEYEPYAKGVAALHVPQTGIVDYKKVALAYGEKFKSLGGEILLNHKVKKIHHKA
DQTELITSGKTIVSRLMINCAGLYSDKVADMNGELDLDVKIIPFRGEYYKLKKEREYLVK
NLIYPVPDPNFPFLGVHFTRMMKGGVEAGPNAVMAFKREGYKRTDFNLKEFRESITWPGL
QKVAAKYWKTGIGEYYRSFSKAAFTTALQELIPDIKEDDLVDGGAGVRAQACDRTGGLLD
DFAITENTHAINVLNAPSPAATSSLSIGGTVSELALKRFL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacatacgatatcgcaattgtgggtggtggcatcgtgggcctggccactggactaaag
ataatactgcagcgaccagaacttaatgtggtcgtcctggaaaaagaaagtgaattggcc
aaacaccaaaccggcaataattccggcgtgatccactcgggcctgtactacaagcctggg
tcactaaaagccaccaattgcatcaatggataccatgaactggtaaaattctgtgaagag
gaaaatattccattcgaaattaccggaaaagtggtggtcgccaccaatgatgagcagcta
ccgttgcttcaaagccttctgaaaagggggctgcaaaatggactgaaaggaactcgtcag
atcaccttggacgagctcaaagagtatgaaccctacgctaaaggcgtggcggccctacac
gtgccacaaaccggcatcgtggattataaaaaagtggctttggcatacggtgaaaagttc
aaatcccttggtggagaaatccttctcaatcacaaggtcaaaaaaatccatcataaagct
gatcaaacggagcttatcacttctggcaaaaccattgtttcccgccttatgatcaactgt
gcgggactttattccgataaggtcgccgatatgaacggtgaactggacctggatgtcaag
atcattccttttcgcggggaatactacaaactcaaaaaagagcgggaatacctggtcaaa
aacctcatttatccagtcccagaccctaacttccctttccttggcgtgcactttacccga
atgatgaaaggcggtgtagaagccggaccaaatgcggtcatggccttcaaacgcgaagga
tacaaaaggacggattttaacctcaaagaattccgtgaatccatcacttggccaggcctt
cagaaagtcgctgccaaatattggaaaaccggtatcggtgaatactaccgctccttctcc
aaagcagcctttaccactgccctgcaagagctgatccctgacatcaaagaagatgacctc
gtggacggtggcgcaggcgtgcgtgcccaagcttgcgatcgtacaggcggcttactggat
gattttgccatcacggaaaatacccacgccatcaacgttctcaatgcccctagtccagct
gctacctcttccctgtccatcggcggaacggtttccgaactggccttgaagcggttttta
tga

DBGET integrated database retrieval system