KEGG   Ehrlichia chaffeensis Liberty: ECHLIB_1019Help
Entry
ECHLIB_1019       CDS       T03190                                 

Definition
(GenBank) flavofamily protein
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
echl  Ehrlichia chaffeensis Liberty
Pathway
echl00770  Pantothenate and CoA biosynthesis
echl01100  Metabolic pathways
Module
echl_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:echl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ECHLIB_1019
Enzymes [BR:echl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     ECHLIB_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein CW_binding_2
Motif
Other DBs
NCBI-ProteinID: AHX07048
Position
1148416..1148958
Genome map
AA seq 180 aa AA seqDB search
MKILLVISGSIAAYKSLDLIRKLQENNHTVTSIISKSGERFVTPLSVASLSGNSVYTDAD
LFHAHKSMHHISLTRSSDIVLVAPATLDIIAKTAHGIADELATTALIASNIPIIMVPAMN
PAMWNSKANQRNIHCLKSDNVTIIEPKEGLAICNEYGTGKMAEVQEIVSFIENFHKTDKK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttattagtaatatcaggaagcatagcagcatataaatctttagatttgata
agaaaactgcaagaaaataaccatacagttactagcataataagcaaatctggagaaagg
tttgttaccccattatcagtagcatcattatctggaaattctgtgtatactgatgcagat
ctttttcatgcccataaaagtatgcatcacatatcattaacgcgaagttctgatattgta
ctagtagcgcctgcaacattagatataatagcaaaaacagcacatggtattgctgatgaa
ttagctacaactgcgttaattgcttcaaacattcctatcatcatggtcccagctatgaat
cctgcaatgtggaattcaaaagcaaatcaacgtaatattcattgtttaaaaagtgataac
gtaacaataattgaacctaaagaagggttagcaatttgtaacgaatacggaacaggtaaa
atggctgaagttcaggagatagtctcattcatagaaaactttcacaaaactgacaaaaaa
taa

DBGET integrated database retrieval system