KEGG   Ehrlichia chaffeensis West Paces: ECHWP_0418Help
Entry
ECHWP_0418        CDS       T03365                                 

Definition
(GenBank) pseudouridine synthase, RluA family protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
echp  Ehrlichia chaffeensis West Paces
Brite
KEGG Orthology (KO) [BR:echp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:echp03009]
    ECHWP_0418
Enzymes [BR:echp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     ECHWP_0418
Ribosome biogenesis [BR:echp03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ECHWP_0418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 DUF1062
Motif
Other DBs
NCBI-ProteinID: AHX10115
Position
complement(459263..460234)
Genome map
AA seq 323 aa AA seqDB search
MLEKKIFIKSGDENNRLDKFIASKLNISRNQVQQLIKDSKILLFDTIIRDNNHITKVNDI
YNISIPTKTISDTITPNHYIPISVVYEDHDIIIINKAPGITVHPGAGTNNNTLVNALVAH
YGNSLSHVGKATRPGIIHRLDKDTSGLMVIAKNEKSYYFLSDLLLKKQIKKEYLAVVWGL
PNPKSNTIKNYICVKPNNKQMMTVTHLPHKGKLAITEYQTQKSFSNIASLIKCRIHTGRT
HQIRVHMSYIGNSIIGDQKYGKNNSKSVKYAKQSTIINTLKRQALHAYKLGFTHPTSNTY
IEFHSDIPNDIQMLIDELEQLSQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgctagagaaaaaaatttttattaaaagtggagatgaaaataacagattagataaattt
atagcaagtaaattaaacatatctcgtaatcaagtacaacaactaataaaagacagtaaa
attctactttttgataccataataagggacaacaatcacataacaaaagtaaatgacatt
tataatataagcatacctacaaaaacaatcagtgacacaattacccctaatcactacata
ccaatttcagtagtatatgaagatcatgatataataataataaacaaagcccctggaata
actgtacatccaggagcaggaacaaataataatacactagtaaatgcactagttgcacat
tacggcaacagtttaagtcatgtaggaaaagcaacaagaccaggaataattcacagatta
gataaggatactagcggactaatggtcattgcaaaaaatgaaaaatcatattatttttta
tctgatctactactcaaaaaacaaataaaaaaagaatacttagcagtagtatgggggtta
cctaaccctaaaagtaatactatcaaaaactatatctgtgtaaaacccaataataaacaa
atgatgactgtgacgcatttaccacataagggtaaattagcaataactgaatatcaaacc
caaaaaagcttcagtaacatagcaagtttaataaaatgtagaatacatacaggtagaaca
catcaaatacgtgtacatatgagttacataggaaactctataataggagatcaaaaatac
ggaaaaaacaacagtaaaagtgtaaaatatgctaaacaaagtaccattatcaatacatta
aaacgacaagcccttcatgcctataaattagggtttactcatcctacgagcaacacatac
atagaatttcattctgacattcctaatgacatacaaatgctaattgacgaattagaacaa
ttaagccaataa

DBGET integrated database retrieval system