KEGG   Ehrlichia chaffeensis Osceola: ECHOSC_0361Help
Entry
ECHOSC_0361       CDS       T03191                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
echs  Ehrlichia chaffeensis Osceola
Pathway
echs03010  Ribosome
Brite
KEGG Orthology (KO) [BR:echs00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ECHOSC_0361 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:echs03011]
    ECHOSC_0361 (rplV)
Ribosome [BR:echs03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ECHOSC_0361 (rplV)
  Bacteria
    ECHOSC_0361 (rplV)
  Archaea
    ECHOSC_0361 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AHX07330
Position
394094..394438
Genome map
AA seq 114 aa AA seqDB search
MSKVLIVAKGMGLKSTPSKLNLVADLIRGKDVSVAMMYLKFCRKKSAGYISKVLKSAVAN
AQANYNIDLDNLYVKEVLVGKSFSLRRIHARARGKACRVYKHYGNVIIKLFERI
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtattgatagtagctaaaggtatggggttgaagtctactccttctaagtta
aatttagttgctgatttaattagagggaaagatgtgtctgttgctatgatgtatttaaaa
ttttgtaggaaaaagtctgctggatatatcagtaaagttttaaaatctgctgttgctaat
gcgcaagctaattataatattgatcttgataatctttacgtaaaagaagttttagttggt
aagtctttttctttacgtaggattcatgctcgtgcacgaggtaaagcatgtagggtgtat
aagcattatggtaatgttatcataaaattatttgagaggatataa

DBGET integrated database retrieval system