KEGG   Ehrlichia chaffeensis Saint Vincent: ECHSTV_0135Help
Entry
ECHSTV_0135       CDS       T03348                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
echv  Ehrlichia chaffeensis Saint Vincent
Brite
KEGG Orthology (KO) [BR:echv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ECHSTV_0135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AHX08896
Position
147266..147670
Genome map
AA seq 134 aa AA seqDB search
MTLQYYSMTKLIEVKVVPSYLEEQSAPHENCYIWLYNIRVKNKSNSTVQLLRRSWKIIDS
TGVINEVTGLGVIGKQPVLKPGEFFEYTSGAYLSTPSGMMHGEYQFMDEDAAQVFYVSIP
MFSLDSPYVNTKPH
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgacactacaatattatagtatgaccaaacttattgaagttaaagttgttccaagttac
ttagaagagcaatctgctccacatgaaaattgttatatatggttgtataacatcagagtt
aagaataaaagtaattctacagtccagctcttgaggagaagttggaaaatcattgattca
acaggtgttattaatgaagtaacaggtttaggagtaataggtaaacagcctgtattaaaa
cctggagagttttttgagtatactagtggtgcatatttaagtactccatctggtatgatg
catggggaatatcaatttatggatgaagatgctgcacaggttttttatgttagtataccg
atgttctcgctagatagtccttatgttaatacaaagccacattaa

DBGET integrated database retrieval system