KEGG   Ehrlichia chaffeensis Wakulla: ECHWAK_0136Help
Entry
ECHWAK_0136       CDS       T03364                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
echw  Ehrlichia chaffeensis Wakulla
Brite
KEGG Orthology (KO) [BR:echw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ECHWAK_0136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AHX09483
Position
147070..147474
Genome map
AA seq 134 aa AA seqDB search
MTLQYYSMTKLIEVKVVPSYLEEQSAPHENCYIWLYNIRVKNKSNSTVQLLRRSWKIIDS
TGVINEVTGLGVIGKQPVLKPGEFFEYTSGAYLSTPSGMMHGEYQFMDEDAAQVFYVSIP
MFSLDSPYVNTKPH
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgacactacaatattatagtatgaccaaacttattgaagttaaagttgttccaagttac
ttagaagagcaatctgctccacatgaaaattgttatatatggttgtataacatcagagtt
aagaataaaagtaattctacagttcagctcttgaggagaagttggaaaatcattgattca
acaggtgttattaatgaagtaacaggtttaggagtaataggtaaacagcctgtattaaaa
cctggagagttttttgagtatactagtggtgcatatttaagtactccatctggtatgatg
catggggaatatcaatttatggatgaagatgctgcacaggttttttatgttagtataccg
atgttctcgctagatagtccttatgttaatacaaagccacattaa

DBGET integrated database retrieval system