KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C0107Help
Entry
UTI89_C0107       CDS       T00338                                 

Gene name
secA
Definition
(GenBank) preprotein translocase; secretion protein
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci02024  Quorum sensing
eci03060  Protein export
eci03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eci00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    UTI89_C0107 (secA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    UTI89_C0107 (secA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    UTI89_C0107 (secA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eci02044]
    UTI89_C0107 (secA)
Enzymes [BR:eci01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     UTI89_C0107 (secA)
Secretion system [BR:eci02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   UTI89_C0107 (secA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C DEAD DUF2175
Motif
Other DBs
NCBI-ProteinID: ABE05617
UniProt: Q1RG97
Structure
PDB: 

Position
110721..113426
Genome map
AA seq 901 aa AA seqDB search
MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKGKTAEFRARLEKGEVL
ENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRTGEGKTLTATLPAYLNA
LTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPAPAKREAYAADITYGTNN
EYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTPLIISGPAEDSSEMYKRVN
KIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVLIEELLVKEGIMDEGESLYS
PANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHTGRTMQGRRWSDGLHQAVEAK
EGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAFEFSSIYKLDTVVVPTNRPMIR
KDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTISIEKSELVSNELTKAGIKHNVLN
AKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGGSWQAEVAALENPTAEQIEKIKAD
WQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSGRQGDAGSSRFYLSMEDALMRIFAS
DRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIY
SQRNELLDVSDVSETINSIREDVFKATIDAYIPPQSLEEMWDIPGLQERLKNDFDLDLPI
AEWLDKEPELHEETLRERILAQSIEVYQRKEEVVGAEMMRHFEKGVMLQTLDSLWKEHLA
AMDYLRQGIHLRGYAQKDPKQEYKRESFSMFAAMLESLKYEVISTLSKVQVRMPEEVEEL
EQQRRMEAERLAQMQQLSYQDDDSAAAAALAAQTGERKVGRNDPCPCGSGKKYKQCHGRL
Q
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgctaatcaaattattaactaaagttttcggtagtcgtaacgatcgcaccctgcgccgg
atgcgcaaagtggtcaacatcatcaatgccatggaaccggagatggaaaaactctccgac
gaagaactgaaagggaaaaccgcagagtttcgtgcgcgtctggaaaaaggcgaagtgctg
gaaaatctgatcccggaagctttcgccgtggtgcgtgaggcaagtaagcgcgtctttggc
atgcgtcacttcgacgttcagttactcggcggtatggttcttaacgaacgctgcatcgcc
gaaatgcgtaccggtgaaggtaaaaccctgaccgcaacgctgcctgcttacctgaacgca
ctaaccggtaaaggcgtacacgtagttaccgtcaacgactacctggcgcaacgtgacgcc
gaaaacaaccgtccgctgtttgaattccttggcctgactgtcggtatcaacctgccgggc
atgccagcaccggcaaagcgtgaagcctacgctgctgacatcacttacggtacgaacaac
gaatacggctttgactacctgcgtgacaacatggcgttcagtcctgaagaacgtgtacag
cgtaaactgcactatgcgctggtggacgaagtggactccatcctgatcgatgaagcgcgt
acaccgctgatcatttccggcccggcagaagacagctcggaaatgtataaacgcgtgaat
aaaattattccgcacctgatccgtcaggaaaaagaagactccgaaaccttccagggcgaa
ggccacttctcggtggatgaaaaatctcgccaggtgaacctgaccgaacgtggtctggtc
ctgattgaagaactgctggttaaagaaggcatcatggatgaaggagagtctctgtactct
ccggccaacatcatgctgatgcaccacgtaacggcggcgctgcgcgctcatgcgctgttt
acccgtgacgtcgactacatcgttaaagatggtgaagttatcatcgttgacgaacacacc
ggtcgtaccatgcagggccgtcgctggtccgatggtctgcaccaggctgtggaagcgaaa
gaaggtgtgcagatccagaacgaaaaccaaacgctggcttcgatcaccttccagaactac
ttccgtctgtatgaaaaactggcggggatgactggtactgctgataccgaagctttcgaa
ttcagctccatctataagctggatactgtcgttgttccgaccaaccgcccaatgattcgt
aaagatctgccggacctggtctacatgactgaagcggaaaaaattcaggcgatcattgaa
gatatcaaagaacgtactgcgaaaggccagccggtgctggtgggtacaatctccatcgaa
aaatcggagctggtgtcaaatgaactgaccaaagccggtattaagcacaacgtcctgaac
gccaaattccatgccaacgaagcggcgattgttgctcaggcaggttacccggctgcggtg
actatcgcgaccaacatggcgggtcgtggtaccgatattgtgctcggtggtagctggcag
gcagaagttgccgcgctggaaaatccgactgcagagcaaattgaaaaaattaaagccgac
tggcaggtacgtcacgatgcggtactggcagcaggtggcctgcatatcatcggtactgaa
cgtcacgaatcccgtcgtatcgataaccagctgcgcggtcgttctggtcgtcagggggat
gctggttcttcccgtttctacctgtcgatggaagatgcgctgatgcgtatttttgcttcc
gaccgagtatccggcatgatgcgtaaactgggtatgaagccaggcgaagccattgagcac
ccgtgggtgaccaaagcgattgccaacgcccagcgtaaagttgaaagccgtaacttcgac
attcgtaagcaactgctggaatatgatgacgtggctaacgatcagcgtcgcgccatttac
tcccagcgtaacgaactgctggatgtcagcgatgtgagcgaaaccatcaacagcattcgt
gaagatgtgttcaaagcgaccattgatgcctacattccgccacagtcgctggaagaaatg
tgggatattccggggctgcaggaacgtctgaagaacgatttcgacctcgatttaccaatt
gccgagtggctggataaagaaccagaactgcatgaagagacgctgcgtgagcgcattctg
gcgcagtccatcgaagtgtatcagcgtaaagaagaagtggttggtgctgagatgatgcgt
cacttcgagaaaggcgtcatgctgcaaactctcgactctctgtggaaagagcacctggca
gcgatggactatctgcgtcagggtatccacctgcgtggctatgcacagaaagatccgaag
caggaatacaaacgtgaatcgttctccatgtttgcagcgatgctggagtcgttgaaatat
gaagttatcagtacgctgagcaaagttcaggtacgtatgcctgaagaggttgaggagctg
gaacaacagcgtcgtatggaagccgagcgtttagcgcaaatgcagcagcttagctatcag
gatgacgactctgcagccgcagctgcactggcggcacaaaccggtgaacgcaaagtagga
cgtaacgatccttgcccgtgtggttctggtaaaaaatacaagcagtgccatggccgcctg
caataa

DBGET integrated database retrieval system