KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C0251
Entry
UTI89_C0251       CDS       T00338                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Brite
KEGG Orthology (KO) [BR:eci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eci02044]
    UTI89_C0251
Secretion system [BR:eci02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   UTI89_C0251
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABE05754
UniProt: Q1RFW0
Position
complement(262531..263034)
AA seq 167 aa
MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPLDERTAIA
INRYNLNAVISEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRL
LELREALVALKSPLGNIPAFRAQLQALLENEDTREQLIQELGIAVQK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgagcaaaatgaacaacaatggcggcagtgtcgcgccgaaagaaagaatcagcgttcgg
tatacaccaaaagttgatggggtggctgctgatatcgaattgccgctgaatttattgatc
accggcaatctgaaagggaaaccagataacacgccgttggatgagcgaactgccattgct
atcaaccgctataacctcaacgcagtcatttcagaagctgacattgaacgggagtttgtt
gttccggctgaactcagtgacgctcccaatgagcaaatgtacgtcaacctgaaagtcaaa
tctatggatgacctttctcctgaccatattgccagccaggtaccagaaataaaacgtctg
ctcgaattgcgtgaagccctagtcgcacttaagtctccactaggcaatattccagccttc
cgcgcacaacttcaggcgctactggaaaacgaagacacccgcgagcagctgatccaggaa
ctgggtatcgccgttcagaaataa

DBGET integrated database retrieval system