KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C0578Help
Entry
UTI89_C0578       CDS       T00338                                 

Gene name
nfnB
Definition
(GenBank) oxygen-insensitive NAD(P)H nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00633  Nitrotoluene degradation
eci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eci00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    UTI89_C0578 (nfnB)
Enzymes [BR:eci01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     UTI89_C0578 (nfnB)
  1.-  
   1.-.-  
    1.-.-.-  
     UTI89_C0578 (nfnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: ABE06078
UniProt: Q1REY6
Structure
PDB: 

Position
complement(590226..590879)
Genome map
AA seq 217 aa AA seqDB search
MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAADNYVFNERKMLDASHVVVFCAKTAMDDAWLKLVVDQEDADGRFATPEAKAANDKG
RKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDEEFGLKE
KGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcatttctgtcgccttaaagcgtcattccactaaggcatttgatgccagcaaa
aaacttaccccggaacaggccgagcagatcaaaactctactgcaatacagcccatccagc
accaactcccagccgtggcattttattgttgccagcacggaagaaggtaaagcgcgtgtt
gccaaatccgctgccgataattacgtgttcaacgagcgtaaaatgcttgatgcctcgcac
gtcgtggtgttctgtgcaaaaaccgcgatggacgatgcctggctgaagctggttgttgac
caggaagatgccgatggccgctttgccacgccggaagcgaaagccgcgaacgataaaggt
cgcaagttcttcgccgatatgcaccgtaaagatctgcatgatgatgcagagtggatggca
aaacaggtttatctcaacgtcggtaacttcctgctgggcgtggcggcgctgggtctggac
gcggtgcccatcgaaggttttgacgccgccatcctcgatgaagaatttggtctgaaagag
aaaggctacaccagtctggtggttgttccggtgggtcatcacagcgttgaagattttaac
gctacgctgccgaaatctcgtctgccgcagaacattaccttaaccgaagtgtaa

DBGET integrated database retrieval system