KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C1154Help
Entry
UTI89_C1154       CDS       T00338                                 

Gene name
ycdW
Definition
(GenBank) putative dehydrogenase
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00260  Glycine, serine and threonine metabolism
eci00620  Pyruvate metabolism
eci00630  Glyoxylate and dicarboxylate metabolism
eci01100  Metabolic pathways
eci01110  Biosynthesis of secondary metabolites
eci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UTI89_C1154 (ycdW)
   00630 Glyoxylate and dicarboxylate metabolism
    UTI89_C1154 (ycdW)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UTI89_C1154 (ycdW)
Enzymes [BR:eci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     UTI89_C1154 (ycdW)
    1.1.1.81  hydroxypyruvate reductase
     UTI89_C1154 (ycdW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 DUF551
Motif
Other DBs
NCBI-ProteinID: ABE06636
UniProt: Q1RDC8
Position
1142814..1143791
Genome map
AA seq 325 aa AA seqDB search
MRINFAQRFSGVSMDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHP
PVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLKPSVPLFRLEDTGMGEQMQEYAVSQV
LHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSR
TRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLAR
GVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPESPLWQHPRVTITPHVAAITRPAEAVE
YISRTIAQLEKGERLCGQVDRARGY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaataaattttgcgcaacgcttttcgggagtcagtatggatatcatcttttatcac
ccaacgttcgatacccaatggtggattgaggcactgcgcaaagctattcctcaggcaaga
gtcagagcatggaaaagcggagataatgactctgctgattatgctttagtctggcatcct
ccagttgaaatgctggcagggcgcgatcttaaagcggtgttcgcactcggggccggtgtt
gattctattttgagcaagctacaggcacaccctgaaatgctgaagccttctgttccactt
tttcgcctggaagataccggtatgggcgagcaaatgcaggaatatgctgtcagtcaggtg
ctgcattggtttcgacgttttgacgattaccgcatccagcaaaatagttcgcattggcaa
ccgcttcctgaatatcatcgggaagattttaccatcggcattttgggcgcaggcgtactg
ggcagtaaagttgcacagagtctgcaaacctggcgcttcccgctgcgttgctggagtcga
acccgtaaatcgtggcctggcgtgcaaagctttgccggacgagaagaactgtctgcattt
ctgagccaatgccgggtattgattaatctgttaccgaatacacctgaaaccgtcggcatt
attaatcaacaattactcgaaaaattaccggatggcgcgtatctcctcaacctggcgcgt
ggtgttcatgtcgtggaagatgacctgctcgcggcgctggatagcgggaaagttaaaggc
gcaatgttggatgtttttaatcgtgaacccttaccgccggaaagtccgctctggcaacat
ccacgcgtgacgataacaccacatgtcgccgcgattacccgtccagctgaagctgtggag
tacatttctcgcaccattgcccagctcgaaaaaggggagaggctctgcgggcaagtcgac
cgcgcacgcggctactaa

DBGET integrated database retrieval system