KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C1392Help
Entry
UTI89_C1392       CDS       T00338                                 

Gene name
ycgS
Definition
(GenBank) protein YcgS
  KO
K05879  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaL [EC:2.7.1.121]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00561  Glycerolipid metabolism
eci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    UTI89_C1392 (ycgS)
Enzymes [BR:eci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     UTI89_C1392 (ycgS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak2
Motif
Other DBs
NCBI-ProteinID: ABE06874
UniProt: Q1RCP0
Structure
PDB: 

Position
complement(1327774..1328484)
Genome map
AA seq 236 aa AA seqDB search
MMTKRWHSGTPLSTPRPLTGVNKEKAMSLSRTQIVNWLTRCGDIFSTESEYLTGLDREIG
DADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQT
TQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSCEQNLPVPAA
LDAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQMLALAAKE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
ttgatgacgaaacgctggcattctgggacgcccctgtccacaccccggcccttaactggg
gtaaataaggagaaagcaatgtcactgagcagaactcaaattgttaactggctcactcgt
tgtggcgatattttcagcaccgagagcgagtatcttactggactggatcgcgagattggc
gacgctgaccacgggctaaatatgaatcgaggctttagcaaagtggtagaaaaactccct
gctatcgcagataaagatatcggtttcattctcaagaataccggcatgacactactttcc
agcgtcggaggtgccagtggtccgctgttcggtaccttctttatccgcgccgcacagaca
acccaggcacggcaaagcctgacgctggaagagctttatcagatgttccgcgatggcgcg
gacggcgtaatcagtcgcgggaaagccgaacctggcgataaaaccatgtgtgatgtgtgg
gtgccggtggtggaatcgttacgtcagtcctgcgagcaaaatctccctgttccggcggcg
ctcgacgctgccagtagcatcgccgaatccgctgcacaaagtacgattacgatgcaagcc
cgcaaaggccgcgccagttatctcggtgaacgcagtattggtcaccaggatcccggcgcg
acctcggtgatgtttatgatgcaaatgttggcgttagccgcaaaagagtaa

DBGET integrated database retrieval system