KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C1432Help
Entry
UTI89_C1432       CDS       T00338                                 

Gene name
galU
Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00040  Pentose and glucuronate interconversions
eci00052  Galactose metabolism
eci00500  Starch and sucrose metabolism
eci00520  Amino sugar and nucleotide sugar metabolism
eci01100  Metabolic pathways
eci01130  Biosynthesis of antibiotics
Module
eci_M00362  Nucleotide sugar biosynthesis, prokaryotes
eci_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    UTI89_C1432 (galU)
   00052 Galactose metabolism
    UTI89_C1432 (galU)
   00500 Starch and sucrose metabolism
    UTI89_C1432 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    UTI89_C1432 (galU)
Enzymes [BR:eci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     UTI89_C1432 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABE06912
UniProt: Q1RCK2
Structure
PDB: 

Position
1366371..1367279
Genome map
AA seq 302 aa AA seqDB search
MAAINTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVADVTAYGV
VDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEFKAWLEEEMGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccattaatacgaaagtcaaaaaagccgttatccccgtagcgggattaggaacc
aggatgttgccggcgacgaaagccatcccgaaagagatgctgccacttgtcgataagcca
ttaattcaatacgtcgtgaatgaatgtattgcggctggcattactgaaattgtgctggtt
actcactcatctaaaaactctattgaaaaccactttgataccagttttgaactggaagca
atgctggaaaaacgtgtaaaacgtcaactgcttgatgaagtgcagtctatttgtccgcca
cacgtgactattatgcaagttcgtcaggggctggcgaaaggcctgggacacgcggtattg
tgtgctcacccggtagtgggtgatgaaccggtagctgttattttgcctgacgttattctg
gatgaatatgaatccgatttatcacaggataacctggcagagatgatccgccgctttgat
gaaacgggtcatagccagatcatggttgaaccggttgctgatgtgaccgcatatggcgtt
gtggattgcaaaggcgttgaattagcgccgggtgaaagcgtaccgatggttggcgtggtt
gaaaaaccaaaagcggatgttgcgccgtctaatctcgctattgtgggtcgttacgtactt
agcgcggatatttggccgttgctggcaaaaacccctcctggagctggtgatgaaattcag
ctcactgacgcaattgatatgctgatcgaaaaagaaacggttgaagcctatcatatgaaa
gggaagagccatgactgcggtaataaattaggttacatgcaggccttcgttgaatacggt
attcgtcataacacccttggcacggaatttaaagcctggcttgaagaagagatgggcatt
aagaagtaa

DBGET integrated database retrieval system