KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C2538Help
Entry
UTI89_C2538       CDS       T00338                                 

Gene name
yfbH
Definition
(GenBank) hypothetical protein YfbH
  KO
K13014  undecaprenyl phosphate-alpha-L-ara4FN deformylase [EC:3.5.1.-]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00520  Amino sugar and nucleotide sugar metabolism
eci01100  Metabolic pathways
eci01503  Cationic antimicrobial peptide (CAMP) resistance
Module
eci_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:eci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UTI89_C2538 (yfbH)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    UTI89_C2538 (yfbH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:eci01005]
    UTI89_C2538 (yfbH)
Enzymes [BR:eci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     UTI89_C2538 (yfbH)
Lipopolysaccharide biosynthesis proteins [BR:eci01005]
 Unusual sugar
  UTI89_C2538 (yfbH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1 AnfG_VnfG
Motif
Other DBs
NCBI-ProteinID: ABE08005
UniProt: Q1R9F9
Position
2506038..2506928
Genome map
AA seq 296 aa AA seqDB search
MTKVGLRIDVDTFRGTREGVPRLLEILSKHNIQASIFFSVGPDNMGRHLWRLVKPQFLWK
MLRSNAASLYGWDILLAGTAWPGKEIGHANADIIREAAKHHEVGLHAWDHHAWQAHSGNW
DRQTMIDDIARGLRTLEEIIGQPVTCSAAAGWRADQQVIEAKEAFHLRYNSDCRGAMPFR
PLLESGTPGTAQIPVTLPTWDEVIGRDVKAEDFNGWLLNRIQRDKGTPVYTIHAEVEGCA
YQHNFVDLLKRAAQEGVTFCPLSELLSGTLPLGQVVRGNIAGREGWLGCQQIAGSH
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcggcttacgcattgatgtcgatacctttcgtggcacccgtgaaggcgtg
ccgcgtctgctggaaatcttgagtaagcataatattcaggccagcatttttttcagcgtc
ggcccggacaatatgggccgccatctctggcgactggtgaagccacagtttttgtggaag
atgctgcgctcaaacgcggcatcgctttatggctgggatattttactggcaggtacggcc
tggccaggtaaagagattggtcatgccaatgccgatatcattcgtgaagcggctaaacat
cacgaagtcggcctgcacgcctgggatcaccatgcctggcaagcccatagcggtaattgg
gatcggcaaacaatgatcgacgatattgcacgcggccttcgcaccctggaagagattatc
ggtcaaccggtaacctgttctgccgctgctggctggcgtgctgaccaacaggtgatcgaa
gcaaaagaagcgttccatttgcgctacaacagcgattgtcgtggggcgatgccgtttcgt
ccattgctcgaatcaggaacccctggcactgcgcaaattccggtgaccttacccacctgg
gatgaagtgattggtcgggatgtgaaagcagaagattttaacggttggttactcaaccgc
atccagcgagataaaggcacgccggtttataccattcatgccgaagttgaaggctgcgct
tatcagcataattttgtggatctcctgaaacgcgcagctcaggaaggcgtgacattttgc
cctttaagcgaactgttatcagggacgttgccgctcggacaagttgttcgcggaaatatt
gccggacgtgaaggctggctgggttgccaacaaattgcgggtagtcactga

DBGET integrated database retrieval system